PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn355141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 311aa    MW: 33457.8 Da    PI: 6.5759
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn355141genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-393392362
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  Achn355141 33 HQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKHSK 92
                6899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-283389IPR003851Zinc finger, Dof-type
PfamPF027011.7E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3853690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MQDIHAIGGG GGGRLFGGGA DRRMRPHHPN HSHQALKCPR CDSLNTKFCY YNNYNLSQPR  60
HFCKNCRRYW TKGGVLRNVP VGGGCRKAKH SKPKSSADAP AREQKSNSNS SSESSSLTAS  120
TTANKTPSAE AMATADLASA STSTSASTLF NFPDSSFFNF SQTTNPSFDP PPPLIDPPSD  180
GGIFPEIGTF TNMMTSSNDP SLLGFNIGEI SASEYRLQQH NHESVLQNHS SNQIACTVRQ  240
ELNMQEISAS GSLDPTAPID LSGIEDRGNH GDLGALDWQI SGYPGLFDLP GTVDPTYWSQ  300
PQWADDGYLP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11118GGRLFGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629175e-51KP662917.1 Cajanus cajan Dof25 (Dof25) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267092.13e-95PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A068TRH11e-94A0A068TRH1_COFCA; Uncharacterized protein
STRINGVIT_17s0000g04850.t012e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-43OBF binding protein 4