PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn353841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 198aa    MW: 22254.1 Da    PI: 9.2903
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn353841genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP72.66.7e-2377125250
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                 C v++C+adls+++eyhrrh+vCe hsk+pvv+v g+eqrfCqqCsr  
  Achn353841  77 CLVDECRADLSKCREYHRRHRVCECHSKTPVVVVGGKEQRFCQQCSRAA 125
                 **********************************************964 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-2271124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.82874155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-2176125IPR004333Transcription factor, SBP-box
PfamPF031101.5E-1677125IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MDWDFTELVQ ENNTQIGSNG FGVHKNAESF SVDLKLGGLG DFRDGLLNKL EEPRVGSIVS  60
SPSKRKKGIH ETQNGLCLVD ECRADLSKCR EYHRRHRVCE CHSKTPVVVV GGKEQRFCQQ  120
CSRAAKQHQE FYATDQHGKV PYSLARNYNG RDKQLPFLLT SDPERSNQAD LKFPSASKLS  180
TTAALPKRVH RKHYPSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-1577123652squamosa promoter-binding protein-like 12
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028107377.16e-39squamosa promoter-binding-like protein 16
RefseqXP_028107378.16e-39squamosa promoter-binding-like protein 16
RefseqXP_028107379.16e-39squamosa promoter-binding-like protein 16
RefseqXP_028107380.16e-39squamosa promoter-binding-like protein 16
TrEMBLA0A2R6P8X31e-85A0A2R6P8X3_ACTCH; Teosinte glume architecture like
STRINGXP_010250660.11e-37(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-21SBP family protein