PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn350751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 407aa    MW: 44649.8 Da    PI: 8.2701
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn350751genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1314.2e-41117193278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 CqvegC+ dls+akeyhr+h+vCe hsk+p+v+v+g+e+rfCqqCsrfh ls+fDe+krsCr+rL++hn+rrrk+q+
  Achn350751 117 CQVEGCNLDLSSAKEYHRKHRVCESHSKCPKVVVAGVERRFCQQCSRFHGLSDFDEKKRSCRKRLSDHNARRRKPQQ 193
                 **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-32111178IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.445114191IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-39115196IPR004333Transcription factor, SBP-box
PfamPF031102.3E-31117190IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MDWNAKWDWE NLVLFNSKTI ESPKKQPTDW GIEEEGEIDP GSFNLYWGGG GGSGSELAHG  60
SSTRSTISAS TDSSPKENSC TGGSAKTSSF SIMPVASSAS AAKKIKSSCH STPPPLCQVE  120
GCNLDLSSAK EYHRKHRVCE SHSKCPKVVV AGVERRFCQQ CSRFHGLSDF DEKKRSCRKR  180
LSDHNARRRK PQQDAIQFNS TKLSAPFFGG RQQMSFVLNN TPLAHTRSTA ITPWECTSSP  240
KFTLTKGYLL KDENPGGISG QLQFSGTELS HAIGMPGQNS NRLLSSKGTK PEVFTQGSKE  300
SMLSFNLDAA QDHRALSLLS TDSWGSEPAT IALDRPFHVN LTTMPQPVMH GVPQSLPLAS  360
SEYWPTERTT DSRYIPSLTA NDSDRFQDIN LFKAPYENSL YSNPLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281161901084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172189KKRSCRKRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028093786.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093787.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093788.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093795.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093800.10.0squamosa promoter-binding-like protein 12
TrEMBLA0A2R6QRD10.0A0A2R6QRD1_ACTCH; Squamosa promoter-binding-like protein
STRINGcassava4.1_006701m1e-122(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.43e-49squamosa promoter binding protein-like 10