PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn345431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 267aa    MW: 29280.2 Da    PI: 9.7394
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn345431genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.7e-392988261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +++ +kcprCds ntkfCyynnysl+qPryfCkaCrryWt+GG+lrnvPvGgg+rk k++
  Achn345431 29 QQQPQKCPRCDSLNTKFCYYNNYSLTQPRYFCKACRRYWTQGGTLRNVPVGGGCRKGKRT 88
                57899***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-262987IPR003851Zinc finger, Dof-type
PfamPF027015.9E-333187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8073387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEQGRREEGN QNRRLKPPAV QPENQLHHQQ QPQKCPRCDS LNTKFCYYNN YSLTQPRYFC  60
KACRRYWTQG GTLRNVPVGG GCRKGKRTKL ASSSSSSAGE SSEKTNLSPQ PSREPHVPQP  120
GNILTTNSGN LGVPPLDSYY SGGGFLSSLA AIQSLNQTPP FNQQLSGSTQ FGGSSNLGFL  180
QGLNVPSFGQ NQQIQQQSEF YQMGNRDQNF VHPNRPLIGS WNQTLMNTSS TTTNPTSSNP  240
SFISNTPGTS LNPNQWPDLQ GYGHPP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447710.17e-73PREDICTED: dof zinc finger protein DOF1.2-like
RefseqXP_012447709.17e-73PREDICTED: dof zinc finger protein DOF1.2-like
RefseqXP_012447708.17e-73PREDICTED: dof zinc finger protein DOF1.2-like
RefseqXP_012447707.17e-73PREDICTED: dof zinc finger protein DOF1.2-like
TrEMBLA0A0D2UNM97e-73A0A0D2UNM9_G
STRINGVIT_10s0003g00030.t019e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-33TARGET OF MONOPTEROS 6