PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn343591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family FAR1
Protein Properties Length: 878aa    MW: 100445 Da    PI: 6.0195
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn343591genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR195.18.5e-3096182290
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                 fYn+YA++vGFs+r+s  ++s+++g+i++r+ vCs+eg+r+e  ++  +++r+r+ tr+gCka+++vkk+  gkw vtkl +eHnHel+
  Achn343591  96 FYNSYARRVGFSTRVSVYQRSRHDGSIICRQIVCSREGFRREGGEN--RSKRQRTITRVGCKAQMTVKKQVLGKWAVTKLIKEHNHELV 182
                 9*****************************************9998..999************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-2696182IPR004330FAR1 DNA binding domain
PfamPF105511.4E-30304395IPR018289MULE transposase domain
PROSITE profilePS5001111.411462869IPR000719Protein kinase domain
PROSITE profilePS5096610.596572620IPR007527Zinc finger, SWIM-type
PfamPF044342.1E-10594618IPR007527Zinc finger, SWIM-type
SMARTSM005753.0E-9595622IPR006564Zinc finger, PMZ-type
SMARTSM002201.7E-7667869IPR000719Protein kinase domain
PfamPF000691.6E-17780869IPR000719Protein kinase domain
SuperFamilySSF561124.16E-30781873IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.102.9E-23783874No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 878 aa     Download sequence    Send to blast
MDFEPLNLEN EVIEFDMGSG DELEEEEEEE EEEEEEEEEE EEEGTQIDLE HADDYEDYND  60
GMFHISSGAH NFNGGDPNLE PYEGMEFDSE QAARIFYNSY ARRVGFSTRV SVYQRSRHDG  120
SIICRQIVCS REGFRREGGE NRSKRQRTIT RVGCKAQMTV KKQVLGKWAV TKLIKEHNHE  180
LVHPDKVHCL RSHRHVSGPA RSLIDTLQAA GMGPSGVMSV LIKESGGINN VGFTKVDCQN  240
YMSSSRQRTL GSGGQHVFDY LKQMQAENPG FYCAVQGDFE NPSGNIFWAD ANSRMNYNYF  300
GDTVTFDTTY RTNRYRVPFA PFTGLNHHGQ PVLFGCALLL NESESSFVWL FQTWLAAMSG  360
RHPISITTDQ DRIIRFAVEQ VFPGTRHRFC KWNVLREAQE KLSYVYLSYP TFEAEFQTCI  420
NVTETVDEFD SCWESILQRY HLGESEWLQS MYNVRHQWVP VYLQDTFFGE MSITKSSDSI  480
NSFFDGYINA STNIHVLIKQ YEKAIASRYE KEVKADYDTI NTAPVLKTPS PMEKQAANLY  540
TRKIFVKFQE ELVETLANPA TVIDDTGAEV MYRVAKFGDD HKAHIIRFDI FGKKARCSCQ  600
MFEFSGILCR HILAVFRVTN VLTLPLHYVL KRWTRSAKSG VVLDNHTLGL PCNYQESSTA  660
RHDNLSREAI KYVEEGAESI HVYDVAMQAL REAAKKVAAA KQNDPDVRKS NVANKSDQKV  720
NISGNRIGQR QSCSVINQDK IIQELTAELE NASQRCEAYR AKLLAVLKNM EEQKLKISVK  780
VQNILTLWYR APEVLLGATH YSTAVDMWSV GCIFAELITK QALFPGDSEL QQLLHIFRFS  840
RKHLLPTKML QYEPSKRISA KKAMEHPYFD DLDKAYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5oo1_A1e-27731874124296Cyclin-dependent kinase 2
5oo3_A1e-27731874124296Cyclin-dependent kinase 2
5osm_A1e-27731874124296Cyclin-dependent kinase 2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028115268.10.0protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2R6RMA00.0A0A2R6RMA0_ACTCH; Protein FAR1-RELATED SEQUENCE like
STRINGVIT_18s0122g00530.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]