PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn339681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 329aa    MW: 36636.8 Da    PI: 9.873
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn339681genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP159.32.1e-49992302136
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskks 100
                 agkkdrhski+T++g+RdRRvRls+e+a++fFdLqd+LGfdk+skti+WLl+++k+aik+l++ ++s+  ece+e+++ ++s  +  k    + k+ k+
  Achn339681  99 AGKKDRHSKICTARGLRDRRVRLSIEIARKFFDLQDMLGFDKASKTIDWLLTKSKTAIKDLVKMKQSNCGECEEEEEEGEVS--KGMKPLVVEGKKVKQ 195
                 89**************************************************************777667774444444444..333444444444444 PP

         TCP 101 qksaasalnlakesrakarararertrekmriknkl 136
                 q+++ +++ la+esra+arararertrekm++++ +
  Achn339681 196 QDRD-AFHLLARESRARARARARERTREKMCKRTIN 230
                 4444.3699999********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-38100226IPR005333Transcription factor, TCP
PROSITE profilePS5136937.036101159IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.799206223IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MFSSSNSTHA FPLLPPSYHL SPPFFGHGGT DIFLHHHHSH PDLLANDLLA ANSPVIDSIF  60
SMMVSSKATN TNQETSGVLI SGNHSSDPHD SVLIPSKKAG KKDRHSKICT ARGLRDRRVR  120
LSIEIARKFF DLQDMLGFDK ASKTIDWLLT KSKTAIKDLV KMKQSNCGEC EEEEEEGEVS  180
KGMKPLVVEG KKVKQQDRDA FHLLARESRA RARARARERT REKMCKRTIN DPKQPLSSIQ  240
VEACERTREL KNKTLMVGCE GNRVISYSKV CQELLSDIAE ESVVIKRKLK SSSSIFNYQQ  300
NPSNDNFKSV ANLGKPATTT TTVNANMV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210222RARARARERTREK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010660504.14e-60PREDICTED: transcription factor CYCLOIDEA
TrEMBLA0A2R6P9X00.0A0A2R6P9X0_ACTCH; Transcription factor CYCLOIDEA like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43332244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.23e-29TCP family protein