PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn324461
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 381aa    MW: 41919.8 Da    PI: 8.2817
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn324461genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP122.81.5e-3885161278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 C v+gC++dl+++++y+rrh+vCe hsk++vv+v g+e+rfCqqCsrf +l efDe+krsCr+rL++hn+rrrk+q+
  Achn324461  85 CFVDGCTNDLTDCRDYYRRHRVCERHSKTQVVVVGGKEKRFCQQCSRFQSLGEFDEAKRSCRKRLDGHNRRRRKPQP 161
                 9*************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3079146IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.09482159IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3683165IPR004333Transcription factor, SBP-box
PfamPF031106.1E-2985158IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MDWELKKSDW DLTELGQEDL VESSSLGVLK NGGGLSVELK LGGLGDLGHG SVGTLKETSG  60
STISSPSSGP SKRSKSISRP QNVSCFVDGC TNDLTDCRDY YRRHRVCERH SKTQVVVVGG  120
KEKRFCQQCS RFQSLGEFDE AKRSCRKRLD GHNRRRRKPQ PEAFYMSSGT YLSNHQGTRL  180
LCFSGPQPHP TSTAGAVPTK PGVATHHQDL HATDQPSILP YSFACIYNGG DKQFPLLLAN  240
DPERSIQTVP EVSISQRLVN NSASPETGWG RKKILFNGST ESVHSKRALS LLSSHTTQTS  300
ETSSSHLLQQ DVNRHNQPIG TGLHYDGLSQ YLRSQGLKEK PPALVPQASN ANHLCDQIFH  360
VAHDDLLENE AFEVLPFSWK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-24851581184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141158KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028107377.11e-168squamosa promoter-binding-like protein 16
RefseqXP_028107378.11e-168squamosa promoter-binding-like protein 16
RefseqXP_028107379.11e-168squamosa promoter-binding-like protein 16
RefseqXP_028107380.11e-168squamosa promoter-binding-like protein 16
SwissprotQ0J0K16e-50SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A2R6RTP80.0A0A2R6RTP8_ACTCH; Squamosa promoter-binding-like protein
STRINGXP_010249063.11e-101(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-39SBP family protein