PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn312101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 262aa    MW: 29323.1 Da    PI: 8.5859
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn312101genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31172225255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+vk L+++hvkSHLQ+YR+
  Achn312101 172 PRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVKELSIAHVKSHLQMYRS 225
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF078478.3E-27496IPR012864Cysteine oxygenase/2-aminoethanethiol dioxygenase
SuperFamilySSF511822.85E-7567IPR011051RmlC-like cupin domain
PROSITE profilePS5129411.415168228IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-30168226IPR009057Homeodomain-like
SuperFamilySSF466891.97E-14170226IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-22172227IPR006447Myb domain, plants
PfamPF002492.9E-8173224IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0016702Molecular Functionoxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDTHKSRPAK LVKNAEMRAP CETTVLYPTS GGNIHCFKAV TPCAIFDILS PPYSADDGRD  60
CTYFRRCQRG NLPANLEERQ YVHMMATTTR SAMAETIEVS DEDQTLGSDH SKKCSPFDLN  120
EVAIDGEDNS GTNEDRATLE GDSSSNNTSL EGRERMSGSS SMVRQYLRSK MPRLRWTPDL  180
HLAFVHAVER LGGQERATPK LVLQLMNVKE LSIAHVKSHL QMYRSKKLDG SGQAPRTKRR  240
GMEAKSTVKF EQRLPKWGQN E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-18173227458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021823024.12e-53uncharacterized protein LOC110764372
TrEMBLA0A2R6QBY11e-100A0A2R6QBY1_ACTCH; Myb family transcription factor
STRINGVIT_12s0028g02080.t018e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-37G2-like family protein