PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn294741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 293aa    MW: 32095.4 Da    PI: 8.237
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn294741genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.21.5e-3166122259
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  + vrY+eClkNhAas+Gg+a DGCgEfmp+ geegt++al C+AC+CHRnFHR+e e 
   Achn294741  66 KMVRYRECLKNHAASMGGNARDGCGEFMPN-GEEGTIEALYCSACNCHRNFHRKEIEG 122
                  679**************************8.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-2468126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.6E-2868120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.1E-3069120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.82170119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.85E-19209281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-30218282IPR009057Homeodomain-like
TIGRFAMsTIGR015652.8E-26220276IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MELSSQEGEV PIPINISYGR GHMIHHGPAP VVPHNHIIIP NSAPQVSTDG TTPTALDLED  60
HGPYKKMVRY RECLKNHAAS MGGNARDGCG EFMPNGEEGT IEALYCSACN CHRNFHRKEI  120
EGEPSSCECF QTDPNRVIGR KLIMGQAHHK NVLGPDQALG PLGYYPSGGT LIPSRQPPAA  180
AAHHQMMMSY NVGSFGSESD ELEEGGGGGG GARPPQLVVK KRFRTKFSQE QKEKMLGFAE  240
RVGWKFQKQE EAVVQQFCQE IGVKRRVLKV WMHNNKHNIA KKSPSSIAPN PI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242212861879ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2001584e-45EU200158.1 Saruma henryi zinc finger-homeodomain protein 2 (ZHD2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003633412.11e-129PREDICTED: zinc-finger homeodomain protein 4
SwissprotO647223e-70ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLA0A2R6R6N30.0A0A2R6R6N3_ACTCH; Zinc-finger homeodomain protein
STRINGVIT_12s0035g01880.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.13e-68homeobox protein 21
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]
  2. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]