PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn293811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family bZIP
Protein Properties Length: 165aa    MW: 19248.6 Da    PI: 7.7417
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn293811genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24.2e-1485134655
                 HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                 + rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L ++l++ ++ 
  Achn293811  85 KRRRMISNRESARRSRMRKQKHLDELWSQVMWLRNENHQLLDKLNRASES 134
                 579**************************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-1380144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.46182145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.0E-1182134No hitNo description
SuperFamilySSF579591.93E-1285133No hitNo description
CDDcd147022.74E-2085136No hitNo description
PfamPF001706.0E-1285133IPR004827Basic-leucine zipper domain
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MHHNEVISQL HCLLPPFPNP YHPHFSSPQN NTPSFQLTKS SNPLPYQLPI TPQVQEFSPQ  60
PTCLNSYSTS DEANEQQLSL INESKRRRMI SNRESARRSR MRKQKHLDEL WSQVMWLRNE  120
NHQLLDKLNR ASESHDRVVQ ENSQLKEEAS ELRLIITDMQ LNSP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028073937.12e-75basic leucine zipper 43-like
RefseqXP_028085357.12e-75basic leucine zipper 43-like
SwissprotQ9FMC21e-37BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A2R6RYG71e-115A0A2R6RYG7_ACTCH; Basic leucine zipper like
STRINGPOPTR_0004s10990.11e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-48basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]