PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn290121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 282aa    MW: 30664.9 Da    PI: 8.4861
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn290121genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-3769128261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 +e+ lkcprCdstntkfCy+nny+l qPr+fCk+CrryWt+GGalr vPvGgg+r++ k+
  Achn290121  69 PEAGLKCPRCDSTNTKFCYFNNYNLMQPRHFCKTCRRYWTRGGALRSVPVGGGCRRSSKK 128
                 67889**************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3553122IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3172127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.86373127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MIFSSSPIYS DHPNWHQLNQ QNHIQQGSFH ETSQLQPPPP PPPVGGGGGN SVRPGSMVDR  60
ARLAKIPQPE AGLKCPRCDS TNTKFCYFNN YNLMQPRHFC KTCRRYWTRG GALRSVPVGG  120
GCRRSSKKVK KSSSSKLGQD QTGPTKSTSE SPSSSGHHFS QLPFMTSLQN LGHYDGGNST  180
GFQMEATGGD AVGQWGSVPF LSGLEAPIHL YHPYQSITHE GVEGHESCGV GVKMDESQLG  240
LNLSRQFISV SENNQYWDGN NTWTEFSGVL NSSSFVGERS A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774236.12e-79PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_009774300.12e-79PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_009774363.12e-79PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_009774425.12e-79PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLA0A061H0305e-77A0A061H030_THECC; OBF-binding protein 3, putative isoform 1
STRINGGLYMA12G06880.23e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.16e-46OBF-binding protein 3