PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn285901
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NF-YC
Protein Properties Length: 85aa    MW: 9383.69 Da    PI: 5.0756
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn285901genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC83.62.2e-264703298
       NF-YC 32 adedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                +++dvkmis eaP+++skacelfi +lt rsw  a ++krrtl+k dia+a+  td fdfl++ v  
  Achn285901  4 SNDDVKMISGEAPIVFSKACELFIEQLTKRSWAVALQAKRRTLRKDDIASAIIATDLFDFLLNLVSD 70
                689***********************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.1E-14155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.4E-23468IPR009072Histone-fold
SuperFamilySSF471133.33E-20470IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MKNSNDDVKM ISGEAPIVFS KACELFIEQL TKRSWAVALQ AKRRTLRKDD IASAIIATDL  60
FDFLLNLVSD STGHEDDCHE AISK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B2e-224692994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024168596.12e-37nuclear transcription factor Y subunit C-9-like
SwissprotQ9FMV52e-22NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
TrEMBLA0A2R6Q8C32e-54A0A2R6Q8C3_ACTCH; Nuclear transcription factor Y subunit C-4 like
STRINGXP_004300774.13e-36(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128811720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63470.27e-25nuclear factor Y, subunit C4
Publications ? help Back to Top
  1. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  2. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  3. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  4. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  6. Qi M, et al.
    QQS orphan gene and its interactor NF-YC4 reduce susceptibility to pathogens and pests.
    Plant Biotechnol. J., 2019. 17(1): p. 252-263
    [PMID:29878511]