PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn285791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 277aa    MW: 30268 Da    PI: 8.928
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn285791genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.6e-3861120362
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 e+ lkcprC+stntkfCy+nny+lsqPr+fCk CrryWt+GGalrnvPvGgg+r  kks+
  Achn285791  61 EAGLKCPRCESTNTKFCYFNNYNLSQPRHFCKVCRRYWTRGGALRNVPVGGGCRWTKKSK 120
                 6779**************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3345113IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3163118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.80764118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVFSSLPVYL DHSNGHLKGY DHVMQPNHQP PLSQQLGAAG ASTWPRSMVD RARLAKIPLP  60
EAGLKCPRCE STNTKFCYFN NYNLSQPRHF CKVCRRYWTR GGALRNVPVG GGCRWTKKSK  120
NKTSKLSHQV MITSANSTPP SRCTSDAPNH FPTLPPSQLP FMASLESLPQ CGSGSSNSGF  180
QSGIGNFLSV GGADQWRLPF LGSLEPPVNF DPYQSEGIEN GVKMEENQNQ LGFNLSRQLG  240
GVSENNHFSW VENANTWAEI SGLNLSSSTT SHLLSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539681.17e-66PREDICTED: dof zinc finger protein DOF3.6
SwissprotQ9M2U12e-48DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A068UKP45e-68A0A068UKP4_COFCA; Uncharacterized protein
STRINGGLYMA12G06880.22e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-44OBF-binding protein 3