PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn282161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family CO-like
Protein Properties Length: 343aa    MW: 37412.9 Da    PI: 6.3944
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn282161genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.71.2e-081143436
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                ++C+ + +  ++lfC+ ++ +lC  C +++H  
  Achn282161 11 KVCDSCTSATATLFCRADSAFLCVGCDTKIHAA 43
                79*****************************54 PP

2zf-B_box25.62.5e-085397341
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 + C+ +e+ +++  C+ +   lC +C   +H+       H++ p
  Achn282161 53 VWLCEVCEQAPASVTCKADAAALCTTCDRDIHSAnplasrHERLP 97
                679*****************************6688888898876 PP

3CCT69.96.6e-24278321144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Achn282161 278 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 321
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.31855IPR000315B-box-type zinc finger
SMARTSM003361.4E-12855IPR000315B-box-type zinc finger
PfamPF006439.6E-71150IPR000315B-box-type zinc finger
CDDcd000213.27E-81255No hitNo description
PROSITE profilePS5011910.6085198IPR000315B-box-type zinc finger
PfamPF006431.9E-65398IPR000315B-box-type zinc finger
CDDcd000211.09E-85498No hitNo description
SMARTSM003362.5E-95698IPR000315B-box-type zinc finger
PfamPF062035.1E-18278320IPR010402CCT domain
PROSITE profilePS5101716.787278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGGESWSLTA KVCDSCTSAT ATLFCRADSA FLCVGCDTKI HAANKLASRH ARVWLCEVCE  60
QAPASVTCKA DAAALCTTCD RDIHSANPLA SRHERLPVIP FYDAAVKPSA IQDGGDERYF  120
SYGGEAEEDE AASWLLPNPN PKVVDSPDLK STDSLFSDVD PYLDIDLMEG DRKPNQNHLQ  180
YGSVADGVVP VRSKNNLQQQ RLQPPSLVDG VPCYDVDYAG SKPFLYNFNS QSLSQSLSSS  240
SLDVGVVPDH NAMAEVSTTT FVQRNAAADS VPVTGIDREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAETR PRIKGRFAKR TEVAHVDAFI SDAAGYGVVP SF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6663311e-39KM666331.1 Ananas bracteatus clone 51620b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028052138.11e-160zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-103COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2R6R4R20.0A0A2R6R4R2_ACTCH; Zinc finger protein like
STRINGXP_009758697.11e-150(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-103CONSTANS-like 4