PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn279201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 98aa    MW: 11372.1 Da    PI: 11.8289
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn279201genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP57.63.3e-1856934077
                EEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP 40 qrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                  f  q  rfhelsefDe+krsCrrrL++hnerrrk++
  Achn279201 56 ANFVYQKNRFHELSEFDEAKRSCRRRLSGHNERRRKTA 93
                569999******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114113.99592IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.47E-135793IPR004333Transcription factor, SBP-box
PfamPF031103.8E-115891IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.103.2E-75879IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MDGPTLPSQV PTTCTRIRKL YKPHLRKERT PSFESGLITS QSPKMRPTTF RLLIAANFVY  60
QKNRFHELSE FDEAKRSCRR RLSGHNERRR KTAAAIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-15squamosa promoter binding protein-like 3