PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn273801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARF
Protein Properties Length: 1340aa    MW: 147041 Da    PI: 7.1246
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn273801genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.62.3e-23799901198
                 EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+kvlt sd++++g +++ +k a+e+     +++++ +++l+  d++g +W++k+i+  +++++r++lt+GW+ Fv +++L +gD++vF+  +++++el
  Achn273801 799 FCKVLTASDTSTHGGFSVLRKQANEClpsldMSQQTPTQELIAIDLHGLEWRFKHIFrgKGQPRRHLLTTGWSTFVTSKRLVAGDTFVFM--REESGEL 895
                 99****************************9555556679***************9977888888*************************..5699*** PP

                 EEEEE- CS
          B3  93 vvkvfr 98 
                 +v+v+r
  Achn273801 896 RVGVRR 901
                 ****98 PP

2Auxin_resp101.31.3e-339271006183
  Auxin_resp    1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83  
                  a+ha++t++ F v+Y+Pr+  s+F++ ++k+++++ +k++vGmRfkm+fe+eds+err++Gt+vgv++l++ +W+nSkWrsLk
  Achn273801  927 ASHAVATGTLFVVYYKPRT--SQFIIGLNKYLESVGNKFAVGMRFKMRFEGEDSPERRFTGTIVGVENLSS-HWENSKWRSLK 1006
                  689***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5135416.508199303IPR002109Glutaredoxin
SuperFamilySSF528332.56E-19204297IPR012336Thioredoxin-like fold
Gene3DG3DSA:3.40.30.106.0E-24210296IPR012336Thioredoxin-like fold
PfamPF004623.0E-11211277IPR002109Glutaredoxin
Gene3DG3DSA:3.40.47.101.6E-68312573IPR016039Thiolase-like
PfamPF001092.3E-54315561IPR014030Beta-ketoacyl synthase, N-terminal
CDDcd008341.30E-153315688No hitNo description
SuperFamilySSF539015.76E-68315566IPR016039Thiolase-like
SMARTSM008256.1E-13317801IPR020841Polyketide synthase, beta-ketoacyl synthase domain
PROSITE patternPS006060469485IPR018201Beta-ketoacyl synthase, active site
SuperFamilySSF539011.34E-42529688IPR016039Thiolase-like
PfamPF028012.0E-24570688IPR014031Beta-ketoacyl synthase, C-terminal
Gene3DG3DSA:3.40.47.101.4E-28578688IPR016039Thiolase-like
SuperFamilySSF1019368.37E-38790930IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.6E-38791916IPR015300DNA-binding pseudobarrel domain
CDDcd100174.25E-17797901No hitNo description
PfamPF023625.2E-20799901IPR003340B3 DNA binding domain
SMARTSM010199.6E-22799903IPR003340B3 DNA binding domain
PROSITE profilePS5086312.055799903IPR003340B3 DNA binding domain
PfamPF065073.7E-319271006IPR010525Auxin response factor
PfamPF023091.8E-512181263IPR033389AUX/IAA domain
SuperFamilySSF542771.57E-1012231303No hitNo description
PROSITE profilePS5174525.23712271308IPR000270PB1 domain
PfamPF023094.3E-512731311IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0045454Biological Processcell redox homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0009055Molecular Functionelectron carrier activity
GO:0015035Molecular Functionprotein disulfide oxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1340 aa     Download sequence    Send to blast
MGCASSKPIE VAVDVYRPPP SSFAVFDINA IKEPWLMADD AHEEHKEKPT HVPVAILDKL  60
NKLESDGPRS WEEVSKALED LKPKLTNPAP PPPNPAPTPP LQPPAQNSPT PAVEKPRKRP  120
SFHTLAELEA KISPKPSEVT RTEFKKTERV KPDSKVVSVP PPESGGYKPL RENIFIVRDK  180
LEREKEGKAP VKWDPLSDYP EKCPPGGSDS VVLYTTSLGG VRRTYEDSNR VRAILETHRV  240
VFEERDVSLH GGFRSELREL LGEGVVVPRL FVKGRYVGGA EEVVGLNETG RLGRLMSWAR  300
VERREAPKRE MDPKKRVVIT GMGLVSVFGS DVDTFYDKLL EGERGITLID RFDASTFSVR  360
FAGQIRDFSS KGYIDGKNDR RLDDCWRYCL VAGRRALDDA KLGPEVLETM DRSKIGVLVG  420
TGMGGLTAFS NGVESLIQKG YKKISPFFIP YSITNMGSAL LAIDTGLMGP NYSISTACAT  480
ANYCFYAAAN HIRRGEANIM VVGGTEAAVM PSGVGGFIAC RALSQRNDEP HKASRPWDKD  540
RDGFVMGEGS GVLIMESLEH AMERGANVIA EYLGGAITCD AHHMTDPRSD GLGVSSCISK  600
ALEDAGVSPE EVNYVNAHAT STLAGDLAEV NAIKKVFKDT SEMKMNGTKA RNLNPINIYS  660
LAVSMIGHGL GAAGGLEAIA TIKAINTGCG GDDLYKELWK ACAGPLVDVP KTGERVFYFP  720
QGHLEQLEAS TNQELNQRIP LFNLPPKILC SVMNIQLRAE QDTDEVYAQI TLVPEQDQTE  780
PLNPVSYPPE PPRTKVHSFC KVLTASDTST HGGFSVLRKQ ANECLPSLDM SQQTPTQELI  840
AIDLHGLEWR FKHIFRGKGQ PRRHLLTTGW STFVTSKRLV AGDTFVFMRE ESGELRVGVR  900
RVGHQQSTMP LSVISSQSMH LGVLATASHA VATGTLFVVY YKPRTSQFII GLNKYLESVG  960
NKFAVGMRFK MRFEGEDSPE RRFTGTIVGV ENLSSHWENS KWRSLKVQWD EPASIARPER  1020
VSPWEIEPFV ASVPSSLVQP VTIKNKRPRP QIKVPVHETA SAIWNPSHGP SQVSGNPEGQ  1080
WSEPNVIWHP KQSEISSTLM NSSTSCLSKT HANGGGWQSP AHISVSRDQF ADEVQDTKSP  1140
SAWSVLSGSL TPCSGNLSSN PLSDLIDGKK IETVASCRLF GVNLKSPLKS ADSSQKLDLS  1200
KISKEYGLGQ MQVLPKEVQS KQSCSSRSRT KVQMQGIAVG RAVDLTALRG YAELIAELEI  1260
MFEIKGDLHP RNKWDIVFTD DEGDMMLLGD HPWPEFCNMV RRIFICSSQE VKKMSAESKI  1320
SPTAADSEGT VLSLDTAET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-164688102913355Auxin response factor 1
4ldw_A1e-164688102913355Auxin response factor 1
4ldw_B1e-164688102913355Auxin response factor 1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
110451049KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9