PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn258341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family FAR1
Protein Properties Length: 674aa    MW: 77925.2 Da    PI: 8.0376
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn258341genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR173.35.3e-2365152291
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                 +Y++YA++ GFs+rks+++ s ++++    +f Cs+eg+r+++  k++k+ ++r  t +gCkakl+++++ +gkw+v+k++ eHnHel++
  Achn258341  65 CYRAYARRKGFSIRKSHTRLS-KDKSLLGVEFACSREGYRRPSYWKKHKNVENRCATMIGCKAKLRLRRD-EGKWVVSKFDVEHNHELCS 152
                 7****************9999.7777******************9999********************99.*****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.8E-2065151IPR004330FAR1 DNA binding domain
PfamPF105514.4E-33272365IPR018289MULE transposase domain
PROSITE profilePS5096610.262553589IPR007527Zinc finger, SWIM-type
PfamPF044341.2E-7553588IPR007527Zinc finger, SWIM-type
SMARTSM005753.5E-4564591IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MATSSDSADI VLPNDCLEQE SVDDLDNVDL LQNETQPPVK SSLYSCPVEP CEGMVFDELE  60
DAETCYRAYA RRKGFSIRKS HTRLSKDKSL LGVEFACSRE GYRRPSYWKK HKNVENRCAT  120
MIGCKAKLRL RRDEGKWVVS KFDVEHNHEL CSPETTPLLP GHRKITRAQK NLIDVLNVSG  180
IPTTKIMSVL RESGGDSNGG YTGMDVQNYL GSKKRKLLED GDAQRMSNYF IKRQSENLDF  240
VYAVQVDGSS CMGNCFWADA RSRLAFQYFG DVVCFDATYI ANRYGMPFVP FAGVNHHQQS  300
VMFGCTVLVN KTTESYIWLF KAWVEAMGGR TPSVIITDDD KAMAMAISQV LPNTTHRLCM  360
WHTLRKVPEY LAHVYNKYPS FHEEFHHCIH DTVTIEEFEN EWNQLMGKYD LRGDSWLKDL  420
YMRREKWVPA YLRMIFCAGM STTQRSESMH KFFKAIVQSS TLASDFVYQY EIALDKRFAS  480
EKERDMETTT TKAILKTCYK MEEEAATTYT RKIFLLFQEE LFSSQKHRAS KYCEEGTRKT  540
YRVLPNGKEK PMYEVVLDGI ENKAICLCHM FEFVGIPCRH ILAVFVKKYL VDYLPQQYVL  600
RRWTTNAKRH GEVVVHEGPQ ISSTLMRNSL MMEFLKVVEE GQKSQRKHHH LTVALRKVHG  660
ELLAMDDERY NRQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018806877.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial
RefseqXP_018855508.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial
RefseqXP_023879877.10.0protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2R6PQ890.0A0A2R6PQ89_ACTCH; Protein FAR1-RELATED SEQUENCE like
STRINGMigut.B01126.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-155FAR1-related sequence 5