PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn253821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 294aa    MW: 31589.8 Da    PI: 6.8648
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn253821genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.53.5e-343690155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt eLHerFv+av+qLGG++kAtPkti+++m vkgLtl+h+kSHLQkYRl
  Achn253821 36 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMAVKGLTLYHLKSHLQKYRL 90
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.533393IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-333391IPR009057Homeodomain-like
SuperFamilySSF466892.69E-173593IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-243691IPR006447Myb domain, plants
PfamPF002491.6E-73889IPR001005SANT/Myb domain
PfamPF143799.8E-27133178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MFSAIGSGVG VHGDFQGLDG PHLAGDPCLV LTTDPKPRLR WTAELHERFV DAVTQLGGPD  60
KATPKTIMRT MAVKGLTLYH LKSHLQKYRL GKQSCKDLPD NSKDASCLAE SQDTDSSASS  120
SSKIAQDLND GYHVTEALRV QMEVQRRLHD QLEVQRRLQL RIEAQGKYLQ SILEKACKVL  180
NDQAAATAGL EAAREELSEL AIKASNDSNG LVPVDALKVP SISELAVSLE NKNPSNLPAR  240
FGDCSIDSCL TSNGSLVSPM GVASQAAAMK KRPRPLFGNG DSVPLEWMIT NSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-203692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-203692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-203692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-203692157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-203692258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1270274KRPRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028102122.11e-167protein PHR1-LIKE 3-like
SwissprotQ8LAJ71e-126PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A2R6R8V40.0A0A2R6R8V4_ACTCH; Protein PHR1-LIKE like
STRINGXP_002518104.11e-161(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-112G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]