PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn251461
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 1024aa    MW: 113639 Da    PI: 5.3023
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn251461genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.9e-41156233178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqve+C adls+akeyhrrhkvCe+hska+ +lv+++ qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  Achn251461 156 ICQVEDCGADLSNAKEYHRRHKVCEMHSKASRALVANVLQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQP 233
                 5**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-33151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.214154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38155236IPR004333Transcription factor, SBP-box
PfamPF031108.0E-30157230IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.1E-6311338IPR020683Ankyrin repeat-containing domain
SMARTSM0024878791821IPR002110Ankyrin repeat
SuperFamilySSF484039.95E-7791907IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-6796909IPR020683Ankyrin repeat-containing domain
CDDcd002042.80E-6796906No hitNo description
SMARTSM0024818847877IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1024 aa     Download sequence    Send to blast
METRLGGEAR LFYGMGMGSV DLRAVGKRSL EWDPNDWRWD GDLFIASPLN SNQSNYQSRQ  60
FFPIGGPGIP ITGGSSNSSS SCSDEVNLGS DKGERELEKR RRVVVVEDDN LEDESGNLTL  120
KLGGHELQIN QREVGNWDGT SGKKTKLLGT SSNRAICQVE DCGADLSNAK EYHRRHKVCE  180
MHSKASRALV ANVLQRFCQQ CSRFHALQEF DEGKRSCRRR LAGHNKRRRK TQPDAAVNSS  240
SLNDAQASGY LLISLLRILT NMHSNKSDNT NDQDLLSLLL RSLASHDGLQ GDKNIYELLQ  300
ESQNLLNSGS STGNSEMVSA LLSNSHQGLS RPMQNNLPVS TSEAPQRGLS VEDARPQVMQ  360
TTTSQNLSTI LAIKDNASPY SEARDISGGR SKLNNFDLND AYVDSDDCIE DVERSPVPLG  420
LGTAALEFPS WVQQDSHQSS PPQTSRNSDS ASTQSPSSSS GETQSRTDRI VLKLFGKEPS  480
DFPFVLRAQI LDWLSHSPTD IESYIRPGCV VLTIYLRLCN SAWEELQCDL TSSLSRLMDA  540
SDDDTFWTTG WLYTRMQHQI AFMYNGQVVA ETSLPLKNDT YSTIQSIKPI AVSMSEGAQF  600
LVKGFNLKRP STRLLCALEG NYLVEEATEE LLDSLDSPEG HDELHFRNFS CSIPAVTGRG  660
FIEVEDNGLS SSFFPFIVAE KDVCSEIRTL ERSIELPETD DIQGESAQIE ARNQALDFVH  720
EMGWLLHRNH LKSRLGHLDP NSGLFPLGRF KWLMEFSMDH DWCAVVKKLL DILLDGTVGA  780
GEHPFLKPAL SEMGLLHRAV RRNSRSLVEC LLKYVPENVT DELRSELSSL VGGDENFLFR  840
PDVAGPAGLT PLHVAAGRDG SEDVLDALTD DPGKVGVEAW KSARDSTGFT PEDYARLRGH  900
YSYIHLVQKK INRTAVTGHV VVDIPAYVPE CNINQKQNEQ QQQPASFQIG NSETRPIQRP  960
CRLCDQKLAY GNANSYLLYR PAMLSMVAIA AVCVCVALFF KSSPEVLFVF RPFRWELLDY  1020
GSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31151230584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198102KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028054458.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A2R6QDQ60.0A0A2R6QDQ6_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_07s0005g02260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]