PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn250031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family FAR1
Protein Properties Length: 993aa    MW: 113200 Da    PI: 6.1245
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn250031genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR181.81.2e-25187273188
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                 +fY++YA  vGFsvrk+  ++sk +g++++r+f+Cskeg+r+++k++  + +++r+etrtgC a++ ++++ dgk+++t++e++HnHe
  Achn250031 187 RFYSKYAGLVGFSVRKDWVNRSKVHGRVVSRKFTCSKEGHRRKDKRD-INVKKHRKETRTGCLAHMIITRQPDGKYRITHFEENHNHE 273
                 5*******************************************999.99999**********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF476993.54E-113398IPR016140Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
CDDcd046601.73E-163797No hitNo description
SMARTSM004991.5E-63797IPR016140Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
PfamPF031018.1E-23187273IPR004330FAR1 DNA binding domain
PfamPF105512.9E-26401494IPR018289MULE transposase domain
PfamPF044345.6E-5681717IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.534681717IPR007527Zinc finger, SWIM-type
SMARTSM005752.6E-7692719IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 993 aa     Download sequence    Send to blast
MAATKSIVSL CTRAMLAFVL ITLVVQTQVA QLRAQTCSDE LGNLNMCAPF VVPGAGSTSP  60
GSDCCSALQA VDHNCFCSTL RIAAQIPSKC NLPPLSCGET SEVLREVALV REMDRSDDDL  120
VSSHEDDTDT RLQTSNNLDL NIEQDCRSPK VAHVRSLQSI LSSKDESNSK VVLKVGMEFE  180
SDEFAYRFYS KYAGLVGFSV RKDWVNRSKV HGRVVSRKFT CSKEGHRRKD KRDINVKKHR  240
KETRTGCLAH MIITRQPDGK YRITHFEENH NHENVNPGNA QNLQELPLQQ GTVDGTGVTE  300
ADSSSNLEKQ SKLALQLLGR RFGTVENIDY PAIDFGNYLK SGRARDLKEG EAGRLMYYFQ  360
RQHYENPSFF HAIQLDVDDK ISNIFWADDN MILDYDHFGD VVCLDTAYRT NKDFRPFVQF  420
LGLNHHRQVL IFGAALMYDE TIDSFKWLFR TFIEAMSGKK PKAILTFQDA TIIQAIDSVL  480
PETNHRVCIW QMYQDALEHL SHVTKDADSF AKDLRSCIFY HEDEEDFINA WDAMIDKFTL  540
QQNDWLRWMF REKEKWALVY GKNTFFIDMK SAHLGEDLSN NLREYLNTDV DVLQFFMRFE  600
SMVNEQRFKE LEANYDMGRC TPRLMANVIL LKHASDLYTP KAFEVFQREY EKCLNVVVKL  660
CIGNGSLFEY KANTFGKPSE YTVTYNSSDD TVTCSCMKFE YVGVLCCHAL KVLDHRNIKV  720
LPACYILKRW TRDARVESLG ESFGTSLEEN PKLITASRYR KLCQRILKIS ARAADSDQAF  780
EYAAKRLDEV MQGVEKILTL KPTEETQALT SSSTGAYASE SEHTEIFLDR NAIEGQDDSH  840
TFMQENEREI MGKDPLNNLG EKISKTKRSQ NVHPPPPDTV TSNSISCPPP AYVSSVSSSL  900
THVSQDFYNF GANFQCLYQP PNLSMDQQPS PDIYQPLSLF SNQHDSPSQG QLLQESLIRC  960
PFQESMLQRN QLRQAMDLDV QHPHSTSFIR FD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028122242.10.0protein FAR1-RELATED SEQUENCE 5-like isoform X3
TrEMBLA0A2R6RQU30.0A0A2R6RQU3_ACTCH; Protein FAR1-RELATED SEQUENCE like
STRINGEOY231120.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-112FAR1-related sequence 5