PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn234991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 429aa    MW: 46881.2 Da    PI: 7.241
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn234991genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP72.38.7e-23177225149
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                 +Cqv+gC++ l +ak+yhrrhkvCe+hskap+v v gleqrfCqqCsr 
  Achn234991 177 RCQVDGCHVALVNAKDYHRRHKVCEMHSKAPKVEVLGLEQRFCQQCSRL 225
                 6**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-24173225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.948175254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-22176226IPR004333Transcription factor, SBP-box
PfamPF031106.4E-18178225IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MENGWSLFNN SGSTSTTTSS RGHNGHCTTT NNIAWDIFDL GTSRFDWTSS PAAADTISHH  60
HHHNTVFNQV DAPPSAAAFA EARGVHALML THQTASLYSS GTHYQPDPHY QLDPHLMCLK  120
LGKRHYFEDA NSPPIGDHHV DGVVSVTKRG RGYYARGVMG PSTSTAVTVD SRAAVPRCQV  180
DGCHVALVNA KDYHRRHKVC EMHSKAPKVE VLGLEQRFCQ QCSRLMFSST SSVVLLKLVS  240
QYRVGAFTGG EFNDITCFLP DFERDPLPCG VGGTEKATTT TGTATRAANL TLPIGRALSL  300
LSSKSDLSSR CSAALRELIA ENRAAILARQ LVLDGRDWQR HHHAMEEASG GQPPSNFPMT  360
SHHHHHHQIF PDAHSWERFN DSGGHVTLDL MQAPNTAFGF LSMRGKYKED EAACSDELWS  420
SFGGNNVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-15178225653squamosa promoter-binding protein-like 12
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028071912.11e-113squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A2R6S1300.0A0A2R6S130_ACTCH; Squamosa promoter-binding-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.44e-22squamosa promoter binding protein-like 10