PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn225111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 306aa    MW: 33517.9 Da    PI: 8.6461
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn225111genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.63.3e-23167218152
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEET CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhel 52 
                 +Cqv+gC++ l +ak+yhrrhkvCe+hskap+v v gleqrfCqqCsr   l
  Achn225111 167 RCQVDGCHVALVNAKDYHRRHKVCEMHSKAPKVEVLGLEQRFCQQCSRSVVL 218
                 6**********************************************97655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.8E-25163215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.64165242IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-22166219IPR004333Transcription factor, SBP-box
PfamPF031102.2E-18168215IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MENGWSLFND CSGTGTATSS RGHNGHCTTN IAWDIFDLGT SRFDWTSTPA TAATNHRHHN  60
TALNQVDAPA STTAFAEARG FHALMLTHQA ASLYASGAHY QPDPHLMCLK LGKRHYFEDA  120
NSPPIGDHHV DGVVSVTKRG RGYYARGVMG PSTSTAVTVD SRAAVPRCQV DGCHVALVNA  180
KDYHRRHKVC EMHSKAPKVE VLGLEQRFCQ QCSRSVVLPK LIGVFAAYEF VLLFAQISKE  240
AEFDLLFARI SKEVPSCAGA RQQRGYLHGN HHRGGRLGNF SKMNGAEEAF FAITEAFIRK  300
FTPIM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A8e-15168221659squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028071912.13e-68squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A2R6R9971e-157A0A2R6R997_ACTCH; Squamosa promoter-binding-like protein
STRINGcassava4.1_008947m3e-55(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.47e-23squamosa promoter binding protein-like 10