PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn219131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 211aa    MW: 23484.3 Da    PI: 8.751
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn219131genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-41130205277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqve+C++d++ ak yhrrhkvCe+h+k pvv+v+g++qrfCqqCsrfhels+fDe+krsCrrrLa+hnerrrk++
  Achn219131 130 CQVENCATDMTYAKPYHRRHKVCEFHAKVPVVAVAGIHQRFCQQCSRFHELSKFDESKRSCRRRLAGHNERRRKSS 205
                 **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-33122191IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.923127204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-38128208IPR004333Transcription factor, SBP-box
PfamPF031101.0E-31130203IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MRNHAEIVNG CTKRSSQEDS MNIINLAKTD KEIIDRDHTK SLKISLSSST SSSLLSSSST  60
TTVLYPLSLC PSTMETSKAG GKRRMKEAME EEEEEEEEDF AGLGSAEEDK KKKVSGRRGS  120
SGGGSTQPSC QVENCATDMT YAKPYHRRHK VCEFHAKVPV VAVAGIHQRF CQQCSRFHEL  180
SKFDESKRSC RRRLAGHNER RRKSSYDITG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-35121203284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022721038.12e-58squamosa promoter-binding-like protein 3 isoform X1
SwissprotQ387417e-55SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A2R6QLD93e-96A0A2R6QLD9_ACTCH; Squamosa promoter-binding-like protein
STRINGEOY282002e-51(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.19e-42squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]