PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn216821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 489aa    MW: 53201.9 Da    PI: 5.8944
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn216821genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-32263317155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr+rWtpeLH++Fveav++L G+e+AtPk +l++m+vkgLt++hvkSHLQkYRl
  Achn216821 263 KPRMRWTPELHDCFVEAVNKLDGAENATPKGVLKIMNVKGLTIYHVKSHLQKYRL 317
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.801260320IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-31261318IPR009057Homeodomain-like
SuperFamilySSF466897.88E-18262317IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-25263318IPR006447Myb domain, plants
PfamPF002492.1E-8265316IPR001005SANT/Myb domain
PfamPF143791.8E-22354400IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MNHHSFMNEP ANEVERSHCT PSSPVHNMLS VESEGQSFSA GECSSSYQSP NVHRDLHSFL  60
GFNCSSTLQP EKFSVKSGLV SAVPYGSHIQ YSKSILSCSS MFCTSLYLSS SSSSETQRQL  120
GNLPFLPHPP SYNQPCSSVQ STTPGLFDGN PSNPHDAGNP EELAEDFLYF PGNTSDSSAH  180
GVNGSNDSIA FTEQLELQFF SDELDMAIGS GGGNPRIDEI YEAPQASSKP AIGLASSQNN  240
HSIGTPLDDL SSQPSPLLPA AHKPRMRWTP ELHDCFVEAV NKLDGAENAT PKGVLKIMNV  300
KGLTIYHVKS HLQKYRLAKY LPERKEDKKA SSSEEKKAAS SCNESDGRIK GSIPFTEALY  360
MQMEVQKQLH EQLEVQRALQ LRIEEHARYL QKILEEQQKA GNSSFFPQGM SQCANRQSGS  420
ELQPSSPPAG ASPYQVADLK TDSSVPLLSK HNTAESSGSR GQALEKKHRL EAKLESASNE  480
DPVPENSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021819954.11e-168myb family transcription factor PHL6
RefseqXP_021819955.11e-168myb family transcription factor PHL6
RefseqXP_021819956.11e-168myb family transcription factor PHL6
SwissprotQ949U21e-112PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A2R6R0N90.0A0A2R6R0N9_ACTCH; Myb family transcription factor
STRINGVIT_09s0054g01620.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2152022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-92G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]