PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn211081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 232aa    MW: 26045.8 Da    PI: 9.8775
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn211081genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.82e-312781358
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                 +++YkeClkNhAa++Gg+a+DGC+Efmp  +++gt +alkC+AC+CHRnFHR+e++
   Achn211081 27 TYNYKECLKNHAAAIGGNATDGCREFMPG-SQQGTLEALKCSACNCHRNFHRKEMQ 81
                 789*************************9.7889*******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.3E-272880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.0E-282980IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.1713079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-203085IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.28E-17158219IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-26159219IPR009057Homeodomain-like
TIGRFAMsTIGR015656.9E-25162218IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MPDKVSKNSR LCMESGNGNV EHIHETTYNY KECLKNHAAA IGGNATDGCR EFMPGSQQGT  60
LEALKCSACN CHRNFHRKEM QVLLAELGYE TGFDYSSVRY HSPLGYSTRQ IQSLGHHKGE  120
VVDRELVGYP TGTLVSTRTA AHQMIVPYKM GVACHSSLEV GKKRLRTKFS REQKEKMLSF  180
AEKSGWKLQK LEKGAVHNFC QETGIKRRVL KVWMHNNKHL SLAKKTTTST I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-211632191874ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003633412.13e-72PREDICTED: zinc-finger homeodomain protein 4
TrEMBLA0A2R6PAS51e-162A0A2R6PAS5_ACTCH; Zinc-finger homeodomain protein
STRINGVIT_12s0035g01880.t011e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-55homeobox protein 31