PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn210451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 195aa    MW: 21716.2 Da    PI: 4.6785
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn210451genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM42.91.5e-13518297128
         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 g  vg+kktLv+y+grap+g +tdWvmheyrl
  Achn210451  51 GGPVGMKKTLVYYRGRAPQGIRTDWVMHEYRL 82 
                 4569**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100519.561109IPR003441NAC domain
PfamPF023651.5E-64482IPR003441NAC domain
SuperFamilySSF1019412.75E-1751110IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDLYHTQINL SCRVEIRNGI FSGQGIGSIR MVSGRIGRRE PDTGSRLGKI GGPVGMKKTL  60
VYYRGRAPQG IRTDWVMHEY RLLDSDNKEC DHETSGIQDS YALCRVFKKN GVCSEIEEQA  120
GQCSSSPLTV ENCQIMINDC DSMSLSPADQ HHVAQASSSS FMDEEENNND DESWMQFITD  180
DAWCSSNTDT LKMI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017439329.12e-50PREDICTED: NAC domain-containing protein 86
TrEMBLA0A2R6P3155e-85A0A2R6P315_ACTCH; NAC domain-containing protein
STRINGVIT_17s0053g00740.t019e-49(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.12e-38NAC domain containing protein 57