PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn209741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 212aa    MW: 22186.5 Da    PI: 8.3957
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn209741genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer77.22.3e-242170757
  ZF-HD_dimer  7 keClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                  eCl+NhAaslG++a+DGCgEf+ + +       l+CaACgCHRnFHR+ +
   Achn209741 21 TECLRNHAASLGSYATDGCGEFTLDVSL-PGGGNLQCAACGCHRNFHRKAT 70
                 7***********************8444.56789**************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152320.5652069IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.7E-202169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.4E-212169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-172268IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.8E-2597176IPR009057Homeodomain-like
SuperFamilySSF466892.59E-1398174IPR009057Homeodomain-like
TIGRFAMsTIGR015652.0E-26108174IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTLPPMLPIS KAGDIGGHHT TECLRNHAAS LGSYATDGCG EFTLDVSLPG GGNLQCAACG  60
CHRNFHRKAT GGSGRGSSVV TTVLYGGGSG GMFVEEESEG AAGGGSGKKR FRTKFTAEQR  120
EKMLGFAEQI GWKMAQRRRD VGSGEDVGDE IERFCRGVGV SRQVFKVWMH NHKNNSSSST  180
SSSSATTTNT TNTTTATPNA SSSLTNFHSL D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-201091791879ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022924045.11e-63zinc-finger homeodomain protein 8-like
RefseqXP_023001812.11e-63zinc-finger homeodomain protein 8-like
RefseqXP_023519958.11e-63zinc-finger homeodomain protein 8-like
SwissprotA2XLF45e-37ZHD11_ORYSI; Zinc-finger homeodomain protein 11
SwissprotQ10DV55e-37ZHD11_ORYSJ; Zinc-finger homeodomain protein 11
TrEMBLA0A2R6P3021e-105A0A2R6P302_ACTCH; Zinc-finger homeodomain protein
STRINGXP_008467173.11e-62(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA118652023
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-30homeobox protein 24