PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn206551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 265aa    MW: 29802.3 Da    PI: 10.4993
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn206551genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP144.11e-44962202134
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskks 100
                 +gkkdrhski+T+ g+RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL+ +++ aike+t+++ ++ s +      ss+ +++++ +  s  ++k +
  Achn206551  96 TGKKDRHSKISTAHGLRDRRMRLSVQIARKFFDLQDMLGFDKASKTIEWLFSKSNGAIKEITRSCRKTTSVA------SSVMEERAKGEFVS--EKKLQ 186
                 79**************************************************************77666333......22222222223333..34444 PP

         TCP 101 qksaasalnlakesrakarararertrekmrikn 134
                 ++ + + +  akesr karararertrekm++ +
  Achn206551 187 RSGKGAYNPQAKESRDKARARARERTREKMMMGS 220
                 444444577788******************9974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.7E-3796185IPR005333Transcription factor, TCP
PROSITE profilePS5136934.28798156IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137012.045198215IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MFTSSCSGNP LSNNTSIEEN SNYSSQEDPN PPFLHFPSPF LDSGDSFVNH LVPQQDKVTN  60
INTTPAEERS SNGRRRKKNP NPDSKPNPNP NPRRRTGKKD RHSKISTAHG LRDRRMRLSV  120
QIARKFFDLQ DMLGFDKASK TIEWLFSKSN GAIKEITRSC RKTTSVASSV MEERAKGEFV  180
SEKKLQRSGK GAYNPQAKES RDKARARARE RTREKMMMGS LKKSKQVLEA NPNSLEQLGF  240
ETTDESCTYS HENNSPLEVV VHVG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021653168.17e-58transcription factor TCP12-like
TrEMBLA0A2R6PH560.0A0A2R6PH56_ACTCH; Transcription factor like
STRINGSolyc04g006980.1.13e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24362359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.19e-28TCP domain protein 12