PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn196331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 445aa    MW: 48574 Da    PI: 9.5087
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn196331genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.9e-41175252178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +CqvegC+ dls+akeyhr+h+vCe hsk+p+v+v g+e+rfCqqCsrfh lsefDe+krsCr+rL++hn+rrrk+q+
  Achn196331 175 RCQVEGCNLDLSSAKEYHRKHRVCESHSKCPKVVVGGVERRFCQQCSRFHGLSEFDEKKRSCRKRLSDHNARRRKPQQ 252
                 6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-33169237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.855173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-39174255IPR004333Transcription factor, SBP-box
PfamPF031101.4E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MDWNAKWDWE NLVLFNSKTI DSPKKQPTDW GIEEEGEIDP GSFNLYWGGG GGSGSELAHG  60
SSTRSTISAS TDSSPKEVIK TSKIVSEACH PFPGDFSKKN ELAIAELSGT SLPLESSVGA  120
GEPLIGLKLG KRTYFENSCT GGSAKPSSFS MMPVASSAST AKKIKSSCQS TPPPRCQVEG  180
CNLDLSSAKE YHRKHRVCES HSKCPKVVVG GVERRFCQQC SRFHGLSEFD EKKRSCRKRL  240
SDHNARRRKP QQDAIQFNST KLSAPFFGGR QQMSFVLNNT PLGHTSSSAS TPWECTSSPK  300
FTLTKGYLLK GENTGGINGQ LQFSGTELSH TIGMPGQNSN RLLPSKGTKP EVFTQGLSYF  360
LNRSLLMTSL SFRVSFKLKL FNVMLPEDLI FPQGFGYDDP NITMMINNDG TLLSARTSKI  420
FLLGKTYKQV WTGMSGGMLQ VPGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281762491184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231248KKRSCRKRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028093786.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093787.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093788.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093795.10.0squamosa promoter-binding-like protein 12
RefseqXP_028093800.10.0squamosa promoter-binding-like protein 12
TrEMBLA0A2R6P3A40.0A0A2R6P3A4_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_01s0010g03710.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-61squamosa promoter binding protein-like 2