PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn195011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 1024aa    MW: 113840 Da    PI: 6.201
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn195011genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322e-41156233178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqve+C adls+ak+yhrrhkvCe+hska+ +lv+++ qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  Achn195011 156 VCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVANVLQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQP 233
                 6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-33151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.325154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38155236IPR004333Transcription factor, SBP-box
PfamPF031106.9E-30157230IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.207.5E-6308327IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.5E-6651652IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484036.5E-7789905IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.5E-6794903IPR020683Ankyrin repeat-containing domain
CDDcd002044.51E-6794904No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1024 aa     Download sequence    Send to blast
METRVGGEAR LFYGMGMGSV DLRAVGKRSL EWDPNDWRWD GDLFIANPLN SNQSNYQSRQ  60
FLPIGEAGIP ITGGSSNSSS SCSDEVNLGT DKGKRELEKR RRVVVVEDDN LEDERSNLTL  120
KLGGHGHQIN QREVRNWDGT GGKKTKLLGT SSNRAVCQVE DCGADLSNAK DYHRRHKVCE  180
MHSKASRALV ANVLQRFCQQ CSRFHALQEF DEGKRSCRRR LAGHNKRRRK TQPDAVANSS  240
SLNDDQASGY LLISLLRILT NMHSNKSDET NDQDLLSHLL RSLASHGGLQ GDKNIYGLLQ  300
ESQNLLNSGS STGNSEMVSA LLSNSPQGLS KPIQHNLPVT TSEASQRGLC LENARTQVMQ  360
TTTSQNPSTI LSIKDNASPY SEARDISGGS RLNNFDLNDA YVDSDDCINL ERSPVPLGLG  420
TVSLECPSWV QQNSHQSSPP QTSRNSDSAS TQSPSSSSGE TQSRTDRIVL KLFGKEPSDF  480
PFVLRAQILD WLSHSPTDIE SYIRPGCVVL TIYLRLYDSA WEELRCDLTS SLSRLLDASD  540
DDTFWTTGWL YTRMQHQIAF MYNGQVVAET SLPLKNDTYS TIQSIKPIAV STSEGAQFLV  600
KGFNLKRPST RLLCALEGNY LVEEATEELL EGLDSPEGHD ELHFRNFSCS IPAVTGRGFI  660
EVEDNGLSSS FFPFIVAEKD VCSEIRTLER LIELPETDDI QGGNAKIEAR NRALDFVHEM  720
GWLLHRNHLK SRLGPLDPNS GLFPLRRFKW LMEFSVDHDW CAVVKKLLNI LLDGTVGAGE  780
QPFLKPALSE MGLLHRAVRR NSRSLVECLL KYVPENVSDE LRTEFSSLVG GDENFLFRPD  840
VVGPAGLTPL HVAAGRDGCE DVLDALTDDP GKVGVEAWKS ARDSTGFTPE DYARLRGHYS  900
YIHLVQKKIN RLAVTGHVVV DIPAYVPDCN INQKQHEQQQ QQQPASFQIG NSETRPIQRP  960
CRLCDQKLAY GNANSYLLYR PAMLSMVAIA AVCVCVALLF KSSPEVLYVF RPFRWELLDY  1020
GSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-31151230584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198102KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028054458.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A2R6PCT30.0A0A2R6PCT3_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_07s0005g02260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]