PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn185971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 1062aa    MW: 119160 Da    PI: 5.9352
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn185971genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.51.4e-36130206177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv++Cead+se+k yhrrh+vC  +++a+vv+++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  Achn185971 130 RCQVPACEADISELKGYHRRHRVCLRCANATVVVLDGQKKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRRRRKP 206
                 6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-27127192IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.633128205IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-33129208IPR004333Transcription factor, SBP-box
PfamPF031106.5E-27131205IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1062 aa     Download sequence    Send to blast
MDPPPTPPLP PPPLSDMENL ISHHDDPLWD WSDFLDFDLD ADADDQFAIS LDSNASPTDQ  60
PPPPTDPVNP SRIRKRDPRM ICSNFLAGRI PCACPELDAK IAEEEEEDGS MIPGKKRVRT  120
ARAVAGTVSR CQVPACEADI SELKGYHRRH RVCLRCANAT VVVLDGQKKR YCQQCGKFHI  180
LSDFDEGKRS CRRKLERHNN RRRRKPSESR VAVEREPHGP VLSDDVACPN ENGKDSMCLS  240
NQITEREPLL ESEEGQISTR CSNPGSENIQ TDSVVSFVAS GEAQIVGEKD ESKYARSSYC  300
EDKSAYSSMC PTGRISFKLY DWNPAEFPRR LRHQIFQWLA SMPVELEGYI RPGCTILTLF  360
IAMPKSMWFK LLEDPVLYIH NLVAAPVKML SGRGTLLVYL DNVIFRAMRV IFICGVDDLP  420
QFMAVTFRSY LWKLTFTFTE LVKTFSHVHS ILMDADGTSV MQVKVEERAP KLHYVHPRCF  480
EAGKPAEFVA CGSNLLQPKF RFLISFAGKY LACDHCVPSL SGDAEGVTTS FDHQLLKIDI  540
PHTEPDLFGP AFIEVENESG LSNFIPILIG NKEICSEMKI MEHRFESSLC LKGSEFMITH  600
SSSDACEVSI QRQTALSQFI LDTAWLLRKP ALEDIEHFLP SSQIGRFNRL LTFLIHNKST  660
CILERVIHYM ENMMDNMNLN SLANGIVDTD MKLLQSNLDH AREILCQRFQ EKVDSAQHSG  720
NLVQQGNCFN RCSQIDTHST LLFDQDMEAM ERGNLVAVAG PNSQDQCVKL PLLNREVVMS  780
VNFTEERPRK SCNRIFTKKY LVSRHLIFVI AAVAVCFGIC EVLLHPQKVG KLATTIRRAT  840
RVEIVLVTAL SVNTCNSDVD LAMLVEECLD STFSCTSLGI VAMAIEQCKN IENGDNNGLE  900
DLENPFIEKK KVVDSEDDES GISGENGSIG MVLLSTAVSI CDSFEFGSRA LITTVGAVLA  960
DKSGRRPLFM ARAYCRTERE TMATTRARVT FRIVLAVLVI VAFFYVFRPL YWKISATVVE  1020
IRQNKQTVTG GISQIVYEAQ KSVGWYQDEF DSGLSDDNRK A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-45126206181squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191203RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028076085.10.0squamosa promoter-binding-like protein 7 isoform X2
TrEMBLA0A2R6RVA40.0A0A2R6RVA4_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54072433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7