PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn181301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 143aa    MW: 15887.4 Da    PI: 7.5058
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn181301genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.12.2e-4258134278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 Cqve+C++d++ ak yhrrhkvCe+h+k pvv+v+g++qrfCqqCsrfhelsefDe+krsCr+rLa+hnerrrk+++
  Achn181301  58 CQVENCATDMTYAKPYHRRHKVCEFHAKVPVVAVAGIHQRFCQQCSRFHELSEFDESKRSCRTRLAGHNERRRKSSH 134
                 **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.3E-571142IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.5E-3450119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.77855132IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.55E-3956136IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3258131IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
METNKAGGKR RMKEEAGEDE EEEEEEDSVG LGSTEDDKKK KVSGRRGTSG GGSTQPSCQV  60
ENCATDMTYA KPYHRRHKVC EFHAKVPVVA VAGIHQRFCQ QCSRFHELSE FDESKRSCRT  120
RLAGHNERRR KSSHDITGEG SG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3649131284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028074804.12e-58squamosa promoter-binding protein 1
SwissprotQ387411e-55SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A2R6RAP85e-97A0A2R6RAP8_ACTCH; Squamosa promoter-binding-like protein
STRINGcassava4.1_018710m4e-52(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-42squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]