PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn172571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family WOX
Protein Properties Length: 236aa    MW: 26301.4 Da    PI: 9.8496
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn172571genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-202079357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq+  Le+l+++  ++p+ae++++++ +l    +++ ++V++WFqN++a++++
  Achn172571 20 SRWNPTKEQISMLENLYKQgIKTPTAEQIQQITGRLqafgHIEGKNVFYWFQNHKARQRQ 79
                7*****************99**************************************97 PP

2Wus_type_Homeobox113.89e-371881265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       a++RW+Pt+eQi +Le+lyk+G++tP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
         Achn172571 18 ASSRWNPTKEQISMLENLYKQGIKTPTAEQIQQITGRLQAFGHIEGKNVFYWFQNHKARQRQKQ 81
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.9971580IPR001356Homeobox domain
SMARTSM003891.6E-51784IPR001356Homeobox domain
SuperFamilySSF466891.8E-121985IPR009057Homeodomain-like
PfamPF000462.9E-182079IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-82079IPR009057Homeodomain-like
CDDcd000864.91E-52175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEDESAADAS DTGGGAPASS RWNPTKEQIS MLENLYKQGI KTPTAEQIQQ ITGRLQAFGH  60
IEGKNVFYWF QNHKARQRQK QKQKQESLAF VNRFLSLPPP CPNVVCSPYY IPQSEYGFYP  120
QYPSKVVLQG GVKRRPRPDR IETHRPSSGA GYESARSVPM NTTASKYSKQ ETLSLFPLEP  180
TGILQAKTTT KRSSPSISTT HSSSSETPKA MDELGSSDYP LFDFFSGNSF SRNRF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028090665.11e-89WUSCHEL-related homeobox 2-like
TrEMBLA0A2R6PQ291e-171A0A2R6PQ29_ACTCH; WUSCHEL-related homeobox like
STRINGGLYMA11G14940.21e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-39WUSCHEL related homeobox 2