PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn169451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 410aa    MW: 44984.6 Da    PI: 8.5823
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn169451genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.8e-38122180260
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 ++k+l+cprC st+tkfCy+nny+++qPryfCk+C+ryWt+GG++rnvP+G+grrk+k 
  Achn169451 122 PDKILPCPRCSSTETKFCYFNNYNVNQPRYFCKNCQRYWTAGGSMRNVPMGSGRRKHKI 180
                 7899****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-28109179IPR003851Zinc finger, Dof-type
PfamPF027016.7E-31124179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.866126180IPR003851Zinc finger, Dof-type
PROSITE patternPS013610128164IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MLVLRDPAIK LFGKTISVQP NKDASSFITP ITPPHVAAAA VVDDLNLVSS TTSFSSDGDF  60
ICISVDDQEN NKKPSEDVKD LEISSGNPEM PSVDNKPTSA KASKNHKLSE TSISQEKILK  120
KPDKILPCPR CSSTETKFCY FNNYNVNQPR YFCKNCQRYW TAGGSMRNVP MGSGRRKHKI  180
SLASHYHRHV MVSESIHNAN ATVLAFCSDL PLCGSIGLTR SSVTVSNSTD HQRGNSGLQE  240
TVVANFQSLA PRVWGPPRAC PPGFNPSAFP VTFYPAPDYW GCTLRGPCWG TCHSSIEPSL  300
CSSPNSQNLG KHSRGGDMIR LSNSEKDSER SCVWIPKTLS IEDPSEGEKS SIWSTLGSKN  360
KTHDSTNRRS MFKAFQSKVD EKNYRDERSL ALQANPAALS RSISFHECV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895107.11e-110PREDICTED: cyclic dof factor 1
TrEMBLS4SKB20.0S4SKB2_ACTCH; Dof zinc finger protein
STRINGVIT_01s0026g02580.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-77cycling DOF factor 2