PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn161751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 294aa    MW: 33273.3 Da    PI: 9.6257
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn161751genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP100.62.8e-3149130283
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                  g+kdrhsk++T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++ak++i+el+ ++ ++ +++++++   +++
  Achn161751  49 FGGKDRHSKVCTVRGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLNAAKHEIDELPPLQIPPGTFFQNHQPIFMTD 130
                 689*************************************************************888887665555444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-2851123IPR005333Transcription factor, TCP
PROSITE profilePS5136931.88751109IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0031347Biological Processregulation of defense response
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MITPSREEDF TTKQGENTVD MKSSRASISS ITPWSRLKNP RIVPVSRAFG GKDRHSKVCT  60
VRGLRDRRVR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLLN AAKHEIDELP PLQIPPGTFF  120
QNHQPIFMTD QGLKINSNVD WNDQLGLSRS NFWNSDGTTR DKSKGVVETT DKREIWIQRN  180
EEVKQGGSSL KGNGANNFFP RPNHPFIPGL LNNAMPYNSF YRLDPPNFPS PQTEDLLNFN  240
AYPPSGMAQT YFPNLHNATP VEFDPKEVNQ FQMLRSNSDN PMPNSLSRQH STH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-1856110155Putative transcription factor PCF6
5zkt_B4e-1856110155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00326DAPTransfer from AT3G02150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028123112.11e-114transcription factor TCP13-like
RefseqXP_028123113.11e-114transcription factor TCP13-like
TrEMBLA0A2R6P9T20.0A0A2R6P9T2_ACTCH; Transcription factor like
STRINGEOY036991e-100(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.13e-47plastid transcription factor 1