PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn158101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family FAR1
Protein Properties Length: 877aa    MW: 100716 Da    PI: 5.9824
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn158101genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR183.34e-2675161188
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                 +fY++YA  vGFsvrk+  ++sk +g++++r+f+Cskeg+r+++k++ ++ +++r+etrtgC a++ ++++ dgk+++t++e +HnH+
  Achn158101  75 RFYSKYAGLVGFSVRKDWVNRSKVHGRVVSRKFTCSKEGQRRKDKRD-VNVKKHRKETRTGCLAHMIITRQPDGKYRITHFEANHNHD 161
                 5*******************************************999.999************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-2375161IPR004330FAR1 DNA binding domain
PfamPF105516.6E-27289382IPR018289MULE transposase domain
PROSITE profilePS509669.792569605IPR007527Zinc finger, SWIM-type
SMARTSM005752.6E-7580607IPR006564Zinc finger, PMZ-type
PfamPF044341.0E-4580605IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 877 aa     Download sequence    Send to blast
MDRSDDDLVS SHEDDMDMRL QVSNNLDLNI EQDCRSPKVA HVRSLQSTLS SKDESNSEGV  60
LKVGMEFESD EYAYRFYSKY AGLVGFSVRK DWVNRSKVHG RVVSRKFTCS KEGQRRKDKR  120
DVNVKKHRKE TRTGCLAHMI ITRQPDGKYR ITHFEANHNH DNVNPGNAQN LQELPLQQGT  180
VDGTGVTEAN SSSNLEKQSQ LAFQLLGRQF GAGENLDYPA IYFDNYLKSG RTRDLKEGEA  240
GCLLYYFQRQ HFENPSFFHA IQLDVDDKIS NIFWADDNMV LDYDHFGDVV CLDTAYRTNK  300
DFRPFVQFLG LNHHRQVVIF GAGLMYDETI DSFKWLFQTF IEAMSGKKPK AILTYQDATI  360
IQAIDSVLPE TNHRVCVWQM YQDALEHLSH VTKDADSFAN DLRSCIFDHE DEEDFINAWD  420
AMIDKFTLQK NDWLRWMFRE KEKWAVVYGK NTFFIDMKST HLGEDLSNNL REYLNTDVDV  480
LQFFMRFESM VNEQRFKELE ANYDMGRCTP RLMANVILLK HASDLYTPKA FEVFQREYEK  540
CLNVVVNLCS GNGSLFEYKA NTFGKPREHT VTYNSTDDTV TCSCMKFEYV GVLCCHALKV  600
LDHRNIKVLP ACYILKRWTR DARVESLRES FRTSLEENPK LITASRYREL CQRILKISAR  660
AADSDQAFEY AARQLDEVMQ GVEKMLTLKP TEETQALTSS STGAYASESE HTEIFLDRNA  720
IEGQDDSHTF MQINEREIMG KDPLNNLGEK ISKTKTSQNV HPPPPDTVTS NSTSCLPPAY  780
VSSASSSLNH VSQDFYNFGA NQVVQCLYQP PNIAMDQQPS PDVYQPPSLL SNQHDSLSQA  840
QLLQAMDLDV QHPHSTSFIR FDQRHRASNG HYFGSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028122242.10.0protein FAR1-RELATED SEQUENCE 5-like isoform X3
TrEMBLA0A2R6RQU30.0A0A2R6RQU3_ACTCH; Protein FAR1-RELATED SEQUENCE like
STRINGEOY231120.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-111FAR1-related sequence 5