PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn157391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 248aa    MW: 28044.4 Da    PI: 7.9057
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn157391genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.36.4e-3266120358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  k rY+eClkNhA+ +GghavDGCgEfmp+ g++g+ +al+CaAC+CHRnFHR++++
   Achn157391  66 KPRYRECLKNHAIGIGGHAVDGCGEFMPA-GADGSLDALRCAACNCHRNFHRKDTD 120
                  679*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2262120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-2968118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.9E-2968119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.45369118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.64E-19173245IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-32173246IPR009057Homeodomain-like
TIGRFAMsTIGR015656.2E-27184240IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MSAQKQVRKC VLERESVHDD EAKKKFNMEF EDEQDEEIEL PYENSSQHKM PNAGGRVADA  60
PPQSRKPRYR ECLKNHAIGI GGHAVDGCGE FMPAGADGSL DALRCAACNC HRNFHRKDTD  120
APPHHHHAHP LLLPHHPQQF TPYYRTQPSG YLHVQQRPLA LPSTSGGGGG QEDDDTTNMS  180
AGSKKRFRTK FTQEQKDKML ELAEKLGWRI QKHDDDVIQQ FCDETGVKRQ VLKVWMHNNK  240
HTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-271832421675ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016740746.15e-94PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
SwissprotQ6YXH55e-77ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A2R6RDD01e-164A0A2R6RDD0_ACTCH; Zinc-finger homeodomain protein
STRINGGorai.003G042700.12e-93(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-70homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]