PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn144801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 433aa    MW: 47782.8 Da    PI: 9.272
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn144801genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.76.2e-42143219177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv+gC++dls+ k+yh+rhkvC+vhsk++ v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Achn144801 143 VCQVHGCNKDLSSSKDYHKRHKVCDVHSKTARVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 219
                 6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-33139205IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.676141218IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-39142223IPR004333Transcription factor, SBP-box
PfamPF031101.6E-31144217IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MESSDSLGRV REVSVGWKMK SSCISHNMFS SNIEAIEGLE LGFPEMMRKS TPINPSLDVL  60
GGEIPNSNPS LGVLGSGLGF SSPSIASDTQ KSSLIEVKLG KFDGWKEAKN SRFSDERSIL  120
TSVGSSLSSK RARAVNLYSQ RPVCQVHGCN KDLSSSKDYH KRHKVCDVHS KTARVIVNGI  180
EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG HNERRRKPQL DTLSDKQYHK LLQYREDARF  240
LRASLPKRLS FVFPDMLPGG FFNPQGNTTN VRGNQSSHIR VDDAPIFRPQ FPMATLNHPG  300
KQFSSEKFPL QLNGYNSALT VQESSGVSNS SSALSLLSAQ SQDLSSHLTA IPMAISPCGV  360
SNSVPVAFGA TSGNDFEVEA SGTCQRSDYV KDKLGHTVDL VQLSSYLQRV EQQRNSMQVK  420
QENDFFCSFP TI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291432171084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010650027.11e-119PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
RefseqXP_010650031.11e-119PREDICTED: squamosa promoter-binding-like protein 6 isoform X3
TrEMBLA0A2R6QQU10.0A0A2R6QQU1_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_01s0011g00130.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-52SBP family protein