PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn141961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 289aa    MW: 33083.9 Da    PI: 6.2666
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn141961genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.93.5e-48101381129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deelv+eyL kk+++++l    ++ e+d++++ePw+Lp+++k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++v++  +++
  Achn141961  10 LPPGFRFYPSDEELVCEYLYKKIANEQLLK-GTLVEIDLHTCEPWQLPEAAKLNSREWYFFSFRDRKYATGYRTNRATISGYWKATGKDRTVHDLrTQA 107
                 79*************************766.78***************88888999************************************9974666 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  vg++ktLvfyk+rap+g k  W+mh++rle
  Achn141961 108 IVGMRKTLVFYKNRAPHGIKIGWIMHDFRLE 138
                 7***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-578156IPR003441NAC domain
PROSITE profilePS5100555.62410156IPR003441NAC domain
PfamPF023654.0E-2511137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGLRDVGASL PPGFRFYPSD EELVCEYLYK KIANEQLLKG TLVEIDLHTC EPWQLPEAAK  60
LNSREWYFFS FRDRKYATGY RTNRATISGY WKATGKDRTV HDLRTQAIVG MRKTLVFYKN  120
RAPHGIKIGW IMHDFRLENP HTPPKEDWVL CRVFHKGKGE SCDNHHHSPE NEFETTTILA  180
TSSHADQPLT FGQNYQTIPC LSQSPPHQTQ NPSSDPLLIN LSSPNPNFLH LSHQEMNNIR  240
SKCDDDYANA LFFDTAFGES SLGDPYGFSQ NLGDMRFDDD DDHSLFFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46915616165NO APICAL MERISTEM PROTEIN
1ut4_B2e-46915616165NO APICAL MERISTEM PROTEIN
1ut7_A2e-46915616165NO APICAL MERISTEM PROTEIN
1ut7_B2e-46915616165NO APICAL MERISTEM PROTEIN
3swm_A2e-46915619168NAC domain-containing protein 19
3swm_B2e-46915619168NAC domain-containing protein 19
3swm_C2e-46915619168NAC domain-containing protein 19
3swm_D2e-46915619168NAC domain-containing protein 19
3swp_A2e-46915619168NAC domain-containing protein 19
3swp_B2e-46915619168NAC domain-containing protein 19
3swp_C2e-46915619168NAC domain-containing protein 19
3swp_D2e-46915619168NAC domain-containing protein 19
4dul_A2e-46915616165NAC domain-containing protein 19
4dul_B2e-46915616165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028111304.11e-131NAC domain-containing protein 21/22-like
TrEMBLA0A2R6P7170.0A0A2R6P717_ACTCH; NAC domain-containing protein
STRINGEOX944241e-120(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.16e-88NAC domain containing protein 74