PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn137981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 423aa    MW: 46853.1 Da    PI: 8.7663
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn137981genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.71.9e-29104187285
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasns 85 
                  g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++WLl + k+ i+ l+ ++ ++ ++++ +++s  + + 
  Achn137981 104 FGGKDRHSKVCTVRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLDATKHDIDNLPPLQMPPGNFSQFHQRSLVSPEL 187
                 689*************************************************************99999888555444444433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.355106164IPR017887Transcription factor TCP subgroup
PfamPF036348.6E-27106221IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MLGVQLASCK ILLPICGPVS AKWLLLKILL IDVGPSSMRV ADEALIAQLN DEERKMIQNS  60
REKDFEAKAE GDANNISKFN KAPSSSRQWS AFKNPRIVRV SRAFGGKDRH SKVCTVRGLR  120
DRRIRLSVPT AIQLYDLQDR LGLSQPSKVV DWLLDATKHD IDNLPPLQMP PGNFSQFHQR  180
SLVSPELNAP QSSLATFFSP IPEFVKEGGV TQSLLPNKEG IKINYNLEDE QFMGKSNAGM  240
EGKLKEVERE STIVEKTKWM RTNEDQSYIP QVSAQNFFPL SSNLSSFPYN YYHFDPSSLS  300
LSQFGPHGLF PPPQTEASNP SNFMSMLSSL ALPSGSQLLL SPPVATPSIF PSFPPYIPNP  360
GESDTRQINH FPFLSSSSHH GLQNPLMPSL HNSFSSPMSA SSKVHLHSHN DERQLNKGNT  420
GS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-17111165155Putative transcription factor PCF6
5zkt_B1e-17111165155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028059156.11e-157transcription factor TCP5-like isoform X2
TrEMBLA0A2R6PRZ30.0A0A2R6PRZ3_ACTCH; Transcription factor like
STRINGEOY220941e-105(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-47TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5