PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn137791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 605aa    MW: 67729.2 Da    PI: 5.5599
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn137791genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-37146206262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +ek l+cprC st+tkfCyynny+ +qPr+fCk+C+ryWt+GG+ rnvPvG+grrknk+s 
  Achn137791 146 PEKVLPCPRCASTDTKFCYYNNYNANQPRHFCKSCQRYWTAGGTTRNVPVGAGRRKNKNSA 206
                 78999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-28133203IPR003851Zinc finger, Dof-type
PfamPF027011.6E-30148204IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.23150204IPR003851Zinc finger, Dof-type
PROSITE patternPS013610152188IPR003851Zinc finger, Dof-type
Gene3DG3DSA:1.10.238.101.9E-20475601IPR011992EF-hand domain pair
PROSITE profilePS502225.503488507IPR002048EF-hand domain
SuperFamilySSF474736.34E-19488599IPR011992EF-hand domain pair
PROSITE profilePS5022213.704533568IPR002048EF-hand domain
PfamPF134991.1E-9536599IPR002048EF-hand domain
CDDcd000512.97E-17537599No hitNo description
SMARTSM000540.0013537565IPR002048EF-hand domain
PROSITE patternPS000180546558IPR018247EF-Hand 1, calcium-binding site
PROSITE profilePS5022210.05570604IPR002048EF-hand domain
SMARTSM000548.5E-4574602IPR002048EF-hand domain
PROSITE patternPS000180583595IPR018247EF-Hand 1, calcium-binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005509Molecular Functioncalcium ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MIVKYQDRFS RDKRKTMKET RDTAIKLFGK RIFLPEYGEI LDVSGNHCAV DCGFKDVNFG  60
IHRGSMMIGC LDDEKVSRTG DEEQGGEAKE ADADVKCEEP ANPGKLRESE ENPKMPSGND  120
ETAMTKPPNI DQTDTSNQEE KTLKKPEKVL PCPRCASTDT KFCYYNNYNA NQPRHFCKSC  180
QRYWTAGGTT RNVPVGAGRR KNKNSASHCH HVIISDTFRA VPNGIHHPRV LSFAPQAPEI  240
KFVDENAPNG FYIFEKDNCS SGSSVTTSNS TEEGDRQVLQ EQIPGNSNSF AFQIPCLPRI  300
PWPYPFNSSV PIGFPMPFYP ASYWNCTIPG AWTVPCLSPP NPTTKQTLGK HSRDGHLLKP  360
KNSDAERSNL IPKTLRIDDP DEAARSSIWA TLGIKNEFNR RSLFKPFKLK GNEKNRVAET  420
PLVLGQYGSV EQSMEANVGC TPKEYGIISL CSLLHWLISL HAFNSLVRCL LESIFHFLCS  480
PPKPSPVHNN KLEREEVEVV MEKLGISRDP NGEHLQERMG SDEIEALFED EEMGLEDARE  540
AFEVFDENCD GFIDASELKR VVCSLGFGEI SKLECEKMIG AFDDNGDGRI DFGEFAKLLE  600
NSSW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619973.11e-123PREDICTED: cyclic dof factor 1-like
TrEMBLA0A0D2U6011e-120A0A0D2U601_G
STRINGPGSC0003DMT4000502731e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-68cycling DOF factor 3