PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn136681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family bZIP
Protein Properties Length: 376aa    MW: 43081.1 Da    PI: 7.251
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn136681genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.16.7e-1274106234
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeek 34 
                 +++k+ rr+++NReAAr+sR+RKka++++Le+ 
  Achn136681  74 PPDKVLRRLAQNREAARKSRLRKKAYVQQLETS 106
                 5799**************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.3E-973124No hitNo description
SMARTSM003381.9E-973137IPR004827Basic-leucine zipper domain
PfamPF001701.6E-875110IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.6875124IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-777119No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
PfamPF141442.0E-29184259IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDSPTAQFVT SRRMGIFESI HQISMWEDFK VDGCQIASAS MIVEEDTKID NQSEDSSQGM  60
PRSSYKFHQG ASKPPDKVLR RLAQNREAAR KSRLRKKAYV QQLETSRLKL VQLEQEVERA  120
RQQLYIPTTS YGDPLMLLSN MLNELTREQL KIREYRYDVG QKNMHGITTF EMEYEHWVKE  180
QERQICELRT ALNCHGVDRD LRSLVDGSMN HYSDLFRMKA TAAKADVFYL MYGMWKTSAE  240
RFFSWIGGFR PSELLKILVA QLDLAHQQVV EVNSLRQSCQ QAEDALSQGM DKLQKILAET  300
VAAGQLGEGS YIQQLTLALE KSEALADHIR QETLQQMSRI LTTHQAAQGL LNLGEYCQRL  360
RTLSSLWATR PCEPA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010652847.11e-167PREDICTED: transcription factor TGA1 isoform X1
RefseqXP_010652848.11e-167PREDICTED: transcription factor TGA1 isoform X1
RefseqXP_019076616.11e-167PREDICTED: transcription factor TGA1 isoform X1
SwissprotQ391621e-144TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A2R6R6840.0A0A2R6R684_ACTCH; Transcription factor like
STRINGEOX922341e-165(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-146TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]