PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn129111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 358aa    MW: 38611.6 Da    PI: 8.3461
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn129111genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.11.3e-4361136176
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                 +CqvegC++dls+ak+y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCr+rLa+hnerrrk+
  Achn129111  61 RCQVEGCKVDLSDAKTYYSRHKVCGMHSKSPKVIVNGLEQRFCQQCSRFHQLPEFDQGKRSCRKRLAGHNERRRKP 136
                 6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-3556123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.37659136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-4160140IPR004333Transcription factor, SBP-box
PfamPF031104.2E-3362135IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGSSSSSSDS LIGLKFGQKI YFEDVGGGAP SKSGGGSPSS AAGTPPKKGR SAVVHGGQPP  60
RCQVEGCKVD LSDAKTYYSR HKVCGMHSKS PKVIVNGLEQ RFCQQCSRFH QLPEFDQGKR  120
SCRKRLAGHN ERRRKPPPGS LFSSHYGRPS SSVFDTGKGG GFVMDFSTFP RFNGKDPWPT  180
TRAQDQNSGN QPAATGKFLS HPWQNESENP PPDLFLQGSA SGTHYSGSTG ECFAGVTDSC  240
CALSLLSNQP WVSQDRSSSL GVSNFLHADS APMVQSAATH GAPVNHFSST LWGFKDNEAS  300
SVSHEMPSDL GLHHIPQPVN HQYSGELELA QHTGRQYMEL EHSRAYDSST QHMHWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31621351184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028078083.11e-168squamosa promoter-binding-like protein 14
TrEMBLA0A2R6QV630.0A0A2R6QV63_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_08s0007g06270.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-71squamosa promoter binding protein-like 9