PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn126821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 360aa    MW: 38637.8 Da    PI: 9.0754
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn126821genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.15.3e-4361136176
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                 +CqvegC++dls+ak+y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l  fD++krsCrrrLa+hnerrrk+
  Achn126821  61 RCQVEGCKVDLSDAKTYYSRHKVCGMHSKSPKVIVNGLEQRFCQQCSRFHQLPAFDQGKRSCRRRLAGHNERRRKP 136
                 6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-3556123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.09459136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-4060140IPR004333Transcription factor, SBP-box
PfamPF031108.4E-3362135IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGSSSSSSDS LIGLKFGQKI YFEDVGAGTP AKSGGGSPSS AAGTPPKKGR SAVVHGGQPP  60
RCQVEGCKVD LSDAKTYYSR HKVCGMHSKS PKVIVNGLEQ RFCQQCSRFH QLPAFDQGKR  120
SCRRRLAGHN ERRRKPPPGS LFSSHYGRPS PSVFDTGKGG GFVMDFSAFP RFNGRDPWPT  180
TTAPDQISGN QPAATGKFLP HPWRNESENP PPDLFLQGSA SGTHYFGSTG ECFSGVTNSG  240
CALSLLSNQP WGPPRDRPSS LGVSNFLHAD GAPMVQSAAT HSAPVNHFSS TSWGFKGNEA  300
SSGSHEMPSD LGLHQIPQPA NNQYSGELEL AQHTGRQYME LEHSPRAYDS STQHMHWLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30621351184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028078083.11e-169squamosa promoter-binding-like protein 14
TrEMBLA0A2R6QV630.0A0A2R6QV63_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_08s0007g06270.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-65squamosa promoter binding protein-like 9