PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn121981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 433aa    MW: 48383.4 Da    PI: 8.4218
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn121981genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.74.5e-37201261262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k l+cprC st+tkfCyynny+ +qPr+fCk+C+ryWt+GG+ rnvPvG+grrknk+s 
  Achn121981 201 PDKVLPCPRCASTDTKFCYYNNYNPNQPRHFCKSCQRYWTAGGTTRNVPVGAGRRKNKNSA 261
                 78999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-27188258IPR003851Zinc finger, Dof-type
PfamPF027012.1E-30202259IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.062205259IPR003851Zinc finger, Dof-type
PROSITE patternPS013610207243IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MVTCQMESLK IRNQFRPRKD SHSSNLYTDR ERRKPKPHGR NDPFTARIIS ASFFSSFLVH  60
FLGDFPGEKR KTMKEARDTT IKLFGKRILV PESGQILDVS GDNYTEDCGF KYRKFEIDRS  120
RSMVIACLDD EKVSRTGDTE QGGEEKEAEG EEPANPGKLG ESDENPKTPS GDEETATTKP  180
PNTENDETDR RNQHEKPLQK PDKVLPCPRC ASTDTKFCYY NNYNPNQPRH FCKSCQRYWT  240
AGGTTRNVPV GAGRRKNKNS ASHCRHVIIS DPLLAAPSGI HHPRVLSFAP QTPVCEINFV  300
DKNVPDGFYK FEKDNGSSGS SVTTSNSKDE GDGKVLQEQI QGNSNSFAFQ IPCLPGIPWP  360
CPLKSLVPIG FPMPFYPAPY WNCTMPGAWT VPCLSPPNPT TKETLGKHSR DGNLLKPKNS  420
DVERSILIPK NL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087240.11e-110PREDICTED: cyclic dof factor 1
TrEMBLC4B6D71e-107C4B6D7_IPOBA; Dof zinc finger protein
STRINGPGSC0003DMT4000502731e-106(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-51cycling DOF factor 3