PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn111031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 250aa    MW: 27279.3 Da    PI: 8.4807
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn111031genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.51.4e-333895260
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                +++ ++cprC s+ntkfCyynny  sqPr+fC+aC+r+WtkGG+lr vPvGggr knk+
  Achn111031 38 PTELVACPRCGSSNTKFCYYNNYKKSQPRHFCRACKRHWTKGGTLRSVPVGGGR-KNKH 95
                678899*********************************************996.5554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-204094IPR003851Zinc finger, Dof-type
PfamPF027011.5E-304194IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.1334296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGLSTKHVNS NEGLDWGKTI LDSGPKPPPA RRQQHQQPTE LVACPRCGSS NTKFCYYNNY  60
KKSQPRHFCR ACKRHWTKGG TLRSVPVGGG RKNKHLKTTT AAAITTSTST STAATGSQQQ  120
SQSLVGDQKD ISGILFHDFI NNSCNFSVKG LSGNNGSFMG STTLPPFTFS SLGTFERYPS  180
SSISTSFGSL DDYNFMEGLT SNNIASQPLW QVPTTSGAMD MPQYWNWEEL ESLVSSEGNI  240
PWDDCEIKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305681.14e-64Dof-type zinc finger domain-containing family protein
TrEMBLB9H2634e-64B9H263_POPTR; Dof-type zinc finger domain-containing family protein
STRINGPOPTR_0004s03900.11e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-26Dof family protein