PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn110851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 277aa    MW: 29212.6 Da    PI: 8.7536
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn110851genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.84.7e-3961145488
         TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                  k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLl q++pai+++tgt++++a++++ + s  s+++  s+
  Achn110851  61 TKKPSKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLHQSEPAIIAATGTGTIPANFSTLNGSIRSGGTTASA 145
                 799****************************************************************999555555444433332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.10965119IPR017887Transcription factor TCP subgroup
PfamPF036341.7E-3565150IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MKLMDSQSNN HQSSTSSGSD HHTHNQQPTN YDLHLLGPGS GQSQPHGPSN NTDSAAANKI  60
TKKPSKDRHT KVDGRGRRIR MPALCAARVF QLTRELGHKS DGETIEWLLH QSEPAIIAAT  120
GTGTIPANFS TLNGSIRSGG TTASAHPSKS PVHGGGATVL GFTGGGLEGF SGDDFMKKRF  180
KEDITPAAEP DRTGMLDREP CSDPNPGSLR PSFLPAPAMW AVGPATSNGG GEGFWMLPAA  240
TALVGAGQPE HQMWPYKGTP VQRIGVFEFP GSVRFI*
Functional Description ? help Back to Top
Source Description
UniProtCan specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022866453.13e-87transcription factor TCP23-like
SwissprotQ9C5186e-53TCP8_ARATH; Transcription factor TCP8
TrEMBLA0A2R6RP681e-155A0A2R6RP68_ACTCH; Transcription factor like
STRINGXP_009624724.15e-85(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35560.11e-51TCP family protein
Publications ? help Back to Top
  1. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]