PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn102591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 1050aa    MW: 115948 Da    PI: 7.2728
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn102591genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.88.3e-40153230178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqve+C+adl++ak+yhrrhkvC++hska+ ++v +l+qrfCqqCsrfh l+efDe++rsCrrrLa+hn+rrrk+++
  Achn102591 153 VCQVEDCRADLTNAKDYHRRHKVCDIHSKASRAVVGNLMQRFCQQCSRFHVLQEFDEGRRSCRRRLAGHNRRRRKTHP 230
                 6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-31148215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.103151228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-37152233IPR004333Transcription factor, SBP-box
PfamPF031106.8E-28154227IPR004333Transcription factor, SBP-box
SMARTSM00248450813843IPR002110Ankyrin repeat
SuperFamilySSF484035.47E-6815931IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.1E-5817930IPR020683Ankyrin repeat-containing domain
CDDcd002041.42E-5818929No hitNo description
SMARTSM002481.5870900IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1050 aa     Download sequence    Send to blast
MEAKFGGKAH QFYGPVIPGV KAVGKTSAEW DLNDWKWDGD LFTAAPLNSI PLDCRSRQLF  60
PVGSEFPTDT LVSNSWSSCS DEVDLGNEKG KRELEKRRRA VVIEDEELND EAGSLKLKLG  120
GQVYPITESE MEKWEGKSGK KSKVVAATSN RAVCQVEDCR ADLTNAKDYH RRHKVCDIHS  180
KASRAVVGNL MQRFCQQCSR FHVLQEFDEG RRSCRRRLAG HNRRRRKTHP ENVANGGSLN  240
DENGSGYLLV SLLRILSNMH SSAGYGNAAN TSDQTKDQDL LTHLLRNLAS LAGSTNGRNT  300
DALLPGSQGL HAGGTSHITP EQVSDLISNR PKCTSILGST SKMDDCFNIQ DSLKPNGECV  360
TVPAFEGTGK RTFTDSTQGG PLQTPSPIPC PTRDSIPSKA SVPENGVGRM KLSDIDLNHA  420
YDDSQNCGET LESYHGPVNL GIGSLDCTFL RNREFQKSCP PQTSGNSGST STQSPSSSSG  480
EAQSRTDRIV FKLFGKDPSH FPLVLRKQIL DWLSHSPTDI ESYIRPGCII LTIYLRLGKS  540
TWEELYCDLS SSLTKLLDAS NDSFWSTGWV YTRLQHRVAF IYNGQAVLDM LLPPKSHKNC  600
RILSIKPIAV PLSEKAQFLV KGFNLSWSTT RLLCALEGKY LLQESCSDMI GGGDILVDHD  660
ESIEIQSRSF SCSIPSVTGR GFIEVEDHSL SSSFFPFIVT DKDVCSEICT LENELELAEI  720
ADNIHPESEM IKARNNALEF IHEIGWLLHR SQLKFRLGHM DPNLDLFPFK RFKWLMEFSI  780
EHDWCAVVKK LLGIVFDGTV DAGEHSSTEL ALLEMGILHS AVRRNCRSMV EMLLRYIPDG  840
ITDKSGSEKQ QQHVNQGSNF LFRPDAIGPG GLTPLHIAVS SDGSESVLDA LTDDPGSVGI  900
EAWKGARDSA GLAPHDYACL RGYYSYIHLV QKKTSKKSGS GHVVLDIPGS LLQCNIKQKL  960
MDGHNSAKVA SFRTEKNEMK PFQGHCKLCL QKRTYGSART SVALYRPAML SMVAIAAVCV  1020
CAALLFKSSP EVLYVFRPFR WELLKYGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291532271084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028067996.10.0LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 12
TrEMBLA0A2R6PK560.0A0A2R6PK56_ACTCH; Squamosa promoter-binding-like protein
STRINGEMJ265940.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1