PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn094351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family bZIP
Protein Properties Length: 626aa    MW: 70921.1 Da    PI: 8.7191
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn094351genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.32.6e-1174106234
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeek 34 
                 +++k+ rr+++NReAAr+sR+RKka++++Le+ 
  Achn094351  74 PPDKVLRRLAQNREAARKSRLRKKAYVQQLETS 106
                 5799**************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.5E-872122No hitNo description
SMARTSM003388.6E-773133IPR004827Basic-leucine zipper domain
PfamPF001703.0E-875109IPR004827Basic-leucine zipper domain
CDDcd147083.65E-2177128No hitNo description
SuperFamilySSF579591.0E-677111No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
PfamPF141442.5E-26163238IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MDSPTAQFVT SRRMGIFEPI HQISMWEDFK VDGCQIASAS MIVEVNTKID NQSEDSSQGT  60
PRSSNKFHQG TSKPPDKVLR RLAQNREAAR KSRLRKKAYV QQLETSRLKL VQLEQEVERA  120
RQQGLYVGDG IDTRHLGYSG NVNSGITTFE MEYELWVKEQ DRQICELRTA LNCHVVDRDL  180
RSLVDGSMKH YFDLFQMKAT AAKAEVFYLM HGIWKTSAER FFSWIGGFRP TELLKILVAQ  240
LDLADQQVYD VCNLRQSCQQ AEDALSQGMD KLQQILAETV AAGQVTLAME KSEALVRFVN  300
QADHLRQVTL QQMSRILTTH QAARGLLNLG EYCQRLRTLS SLWATRPCVT IISKIKTVCI  360
DIYVNDLPHK LHIYLRSGVK LSLSMAKRKV KRTVKQSASS PLSSKNCTGP KEPPILEKED  420
VFRDPEVERR SAAIRGIRDV EIDHLLTGLH LLRSYFRQEQ LQTPVLQFFE ENLPNLSVLR  480
NGKDGQYEVQ WKEKDGNLSM NLSMNQLVVS YVTIKLLTEK ASLLGADNLQ IRDFVLEEPS  540
DTHMLGLQDA LQTPGATSHR MSVGMTPKTL RLPKPGEMLL SVHGSPLGVY KEDNMESIQG  600
NQDEILAQDR NSNVSTRTYR NAPKL*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028077750.10.0transcription factor TGA1-like isoform X2
RefseqXP_028077751.10.0transcription factor TGA1-like isoform X2
RefseqXP_028077752.10.0transcription factor TGA1-like isoform X2
SwissprotQ391621e-160TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A2R6S3C20.0A0A2R6S3C2_ACTCH; Transcription factor like
STRINGEOX922341e-178(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-162TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]