PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn074571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 267aa    MW: 29657.7 Da    PI: 8.4061
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn074571genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.55.7e-324399259
  ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 + vrY+eClkNhAas+Gg+a DGCgEfmp+ geegt +al+C+AC+CHRnFHR+e e 
   Achn074571 43 KMVRYRECLKNHAASMGGNARDGCGEFMPN-GEEGTLEALTCSACNCHRNFHRKEIEG 99
                 679**************************8.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2445103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.2E-294597IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-304697IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.0674796IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.35E-18184256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-29191256IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-25195251IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MIHHGPAPVP HNHIIVPNLA PQVPSNGSTP TALDLEDHVP YKKMVRYREC LKNHAASMGG  60
NARDGCGEFM PNGEEGTLEA LTCSACNCHR NFHRKEIEGE PSSCECFQTA PNRVIERKWI  120
MGQAYHKNVL GPDQALGPIG YYPSGGALIR SRPPPAAAAH HQMMMSYNVG SFGSESDELE  180
AGDGGGARPP QLVVKKRFRT KFSQDQKEKM LNFAERVGWK FQKQEEDVVQ QFCQEIGVKR  240
RVLKVWMHNN KFNLAKENTS IAQNPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-221962511873ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003633412.11e-119PREDICTED: zinc-finger homeodomain protein 4
SwissprotO647225e-67ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLA0A2R6RGG60.0A0A2R6RGG6_ACTCH; Zinc-finger homeodomain protein
STRINGVIT_12s0035g01880.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.13e-69homeobox protein 21
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]
  2. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]